KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_04140Help
Entry
PSJM300_04140     CDS       T02182                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00473  D-Alanine metabolism
psj00550  Peptidoglycan biosynthesis
psj01100  Metabolic pathways
psj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSJM300_04140 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSJM300_04140 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PSJM300_04140 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psj01011]
    PSJM300_04140 (ddl)
Enzymes [BR:psj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PSJM300_04140 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:psj01011]
 Precursor biosynthesis
  Amino acid ligase
   PSJM300_04140 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATP-grasp_3 RimK ATP-grasp_5 ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AFN76906
LinkDB All DBs
Position
917526..918470
Genome map
AA seq 314 aa AA seqDB search
MNALQSTREPRDFGRVAVLFGGKSAEREVSLKSGEAVLGALQAAGVDAFGIDVGDDFLQR
LSTERIDRAFIVLHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWLSLGL
PTPRHAVLASEEDCEAAAKTLGFPLIVKPAHEGSSIGMAKVGGLGELIAAWRDASAYDAQ
VLVEQWIQGPEFTIATLRGQVLPPIGLGTPHTFYDYDAKYLADDTQYRIPCGLDGEKEAE
LKTLSARACEAVGIQGWARVDVMQDADGAFWLLEVNTVPGMTDHSLVPMAANAAGLDFQQ
LVLAILDDSLAARS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgctgcaatccacccgtgagccgcgggacttcggccgtgtggcggtgctgttc
ggtggcaagagcgccgaacgggaggtgtccctcaaatccggcgaagcggtgctgggtgca
ttgcaggcggcgggcgtcgatgcattcgggatcgacgtcggtgacgatttcctgcagcgc
ctgagcacggagcgcatcgatcgcgccttcatcgtcctgcatggtcgtggcggcgaagac
ggcagcatgcaggggctgctcgagtgcgccggcattccctacaccggcagcggcatcctc
gcttcggcgctggccatggacaagctgcgcaccaagcaggtctggctgagcctcgggctg
ccgacgccgcgccatgccgtactggccagcgaagaggattgcgaagcggccgcgaagacg
ctggggttcccgctgatcgtcaagccggcacatgaaggctccagcatcggcatggccaag
gtgggtgggctgggcgagctgatcgccgcctggcgcgacgcgagtgcctacgacgcgcaa
gtgctggtggagcaatggattcagggccccgagttcaccatcgccaccttgcgcgggcag
gtattgccgccgatcgggctgggcacgccccacaccttctacgactacgacgccaagtac
ctggccgacgatacccagtaccggattccctgtgggctggatggcgagaaggaagccgag
ctcaagacgctttctgcgcgtgcctgtgaggccgtaggtatccagggctgggcgcgcgtc
gacgtgatgcaggacgccgacggcgccttctggctgctcgaggtcaacacggtgccgggc
atgaccgatcacagcctggtgccgatggcggccaatgcggccggattggatttccagcag
ctggtgctggcgattctcgatgacagcctggcggcgaggagctag

DBGET integrated database retrieval system