KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13460Help
Entry
PSJM300_13460     CDS       T02182                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00020  Citrate cycle (TCA cycle)
psj00190  Oxidative phosphorylation
psj00650  Butanoate metabolism
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
Module
psj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSJM300_13460 (sdhA)
   00650 Butanoate metabolism
    PSJM300_13460 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PSJM300_13460 (sdhA)
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PSJM300_13460 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PSJM300_13460 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AFN78754
LinkDB All DBs
Position
2951552..2953324
Genome map
AA seq 590 aa AA seqDB search
MASIRTLSYDAIIIGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDYGKGGQAARTCAAADRTGHALLHTLYQGNLKAGTSFLNEWYAVDLVKNQDGAI
VGVIAICIENGETVYIRSKAVVLATGGAGRIYASTTNALINTGDGIGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
LAGNGCGPNGDHVMLKLDHLGEEVLHSRLPGICELSKTFAHVDPVTAPVPVVPTCHYMMG
GVATNIHGQAITQDANGNDKIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKEGVEHRGATETDLDTALNRLASLNERTTGEDVASLRKELQSCMQNYFGVFRTGE
YMQKGIAQLADLRQRIASVKISDKSQAFNTARIEALELQNLLEVAEATAIAAETRKESRG
AHAREDFEERDDENWLCHTLYFPGEKRVSKRAVNFSPKTVPTFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattcgtactctttcctatgacgccatcatcatcggtggcggtggtgctggc
atgcgtgccgcactgcaactggcccagggtggccacaagactgccgtggtcaccaaggtg
ttcccgacccggtcgcacaccgtttccgcccagggtggcatcacctgcgccatcgcttcg
gccgacccgaacgatgactggcgctggcacatgtacgataccgtcaagggttccgattac
atcggcgaccaggacgctatcgaatacatgtgttccgtaggacccgaagcggtattcgaa
ctggagcacatggggctgccgttctcccgtaccgagcagggccgcatctatcagcgtcca
ttcggtggtcagtcgaaggactacggcaagggcggccaggccgctcgtacctgtgccgct
gctgaccgcaccggccacgcgctgctgcacacgctttaccagggcaacctgaaagccggc
acatctttcctcaacgagtggtacgcagtcgatctggtcaagaaccaggacggcgccatc
gttggcgtgatcgcgatctgcatcgagaacggcgagaccgtttatatccgttccaaggcc
gtagtgctggccactggcggtgccggtcgtatctatgcctccaccaccaacgcattgatc
aataccggtgacggtatcggcatggcgctgcgtgcaggcgtgccggttcaggacatcgag
atgtggcagttccacccgaccggtatcgccggcgctggtgtactggtcaccgaaggctgc
cgcggtgaaggcggttacctgatcaacaagcatggcgagcgcttcatggagcgttacgct
ccgaacgccaaggatcttgccggtcgtgacgtggttgcacgttccatggtcaaggaaatc
ctcgccggcaatggctgcggtccgaatggcgatcacgtcatgctcaagctcgatcacctg
ggcgaggaggtgctgcacagccgcctgcctggtatctgtgagctgtcgaagaccttcgct
catgtcgacccggttaccgctccggttccggtcgttccgacctgccactacatgatgggt
ggtgtcgccaccaatattcatggtcaggcgatcacccaggatgccaatggcaacgacaag
atcgtcgaaggtctgttcgcggttggcgaagtggcttgcgtatcggttcatggtgccaac
cgcctgggtggcaactcgctgctcgacctggtggtgttcggccgtgccgctggtctgcac
ctggagaaggcactgaaggaaggtgtcgagcatcgtggcgctaccgagaccgatctggat
acggcgctcaaccgccttgccagcctcaacgagcgtaccactggcgaagacgtcgcctct
ctgcgcaaagagctgcagagctgcatgcagaactatttcggtgtgttccgtaccggtgaa
tacatgcagaagggtatcgcccagttggccgatctgcgtcagcgcatcgccagcgtgaag
atctccgacaagagccaggcgttcaataccgctcgtatcgaagcgctcgagctgcagaac
ctgttggaagtcgccgaagctaccgcgattgccgcggaaactcgcaaggaatcgcgcggc
gctcacgctcgcgaagacttcgaagagcgtgacgacgaaaactggctgtgccacaccctg
tatttcccgggtgagaagcgtgtatccaagcgtgccgtgaacttctctccgaagacagta
ccgacattcgagcccaaggttcggacatactga

DBGET integrated database retrieval system