KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_17185Help
Entry
PSJM300_17185     CDS       T02182                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00550  Peptidoglycan biosynthesis
psj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSJM300_17185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psj01002]
    PSJM300_17185
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psj01011]
    PSJM300_17185
Enzymes [BR:psj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PSJM300_17185
Peptidases and inhibitors [BR:psj01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   PSJM300_17185
Peptidoglycan biosynthesis and degradation proteins [BR:psj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PSJM300_17185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AFN79492
LinkDB All DBs
Position
complement(3732179..3733336)
Genome map
AA seq 385 aa AA seqDB search
MNITPYVQRLVFLTLLIVVPAAWAAPIIPSAPQLAAKSYVLMDAASGEVLVEDAGDERLP
PASLTKLMTAYIATLEIKKGQIAESDMVTVSEKAWRTGGSRMFIQVNTQVSVDDLLHGII
IQSGNDASVAMAEYIAGSEEAFADLMNSTAQRLGMTNSHFMNATGLPHPEHYSSARDMAK
LARAIIDEDPEHYAIYAQKEFFWNNIKQPNRNLLLWRDKTVDGLKTGHTEEAGYCLVASA
VRDGMRLISVVFGTASEQARAAETQKLLTYGFRFFETRTFYEKGVELAQPKVWKGQQDKV
AAGLAKDLTLTLPRGQLDKLEAGMTFKSNLIAPIQQGDVIGTVEVKLEDKVLHSTDLIAL
QSVEEGGLFRRFWDSIRLFFFGLFN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaccccttacgtgcagcgcctggtctttctcaccctgctgatagtcgtgccg
gccgcatgggccgcgccgatcatcccttcagcaccccagctggcagctaagtcctacgtg
ctgatggatgccgccagcggtgaggtgctggtcgaggatgccggcgatgagcgcctacct
ccggcgagcctgaccaagctgatgacggcctacatcgccaccctggaaatcaagaagggc
cagatcgccgagagcgacatggtcacggtcagcgagaaggcctggcgtaccggtggttcg
cggatgttcatccaggtcaacacccaggtttccgtggacgacctgctgcacggcatcatc
atccagtcgggcaacgacgccagcgtcgccatggccgaatacatcgccggcagcgaggaa
gccttcgccgacctgatgaacagcacggcgcagcgcctgggcatgaccaacagccacttc
atgaacgccaccggcctgccgcacccggagcactactcctcggcgcgggacatggccaag
ctggcgcgggcgatcatcgatgaagaccccgagcactatgccatctatgcccagaaggaa
ttcttctggaacaacatcaaacagcccaaccgcaacctgctgctgtggcgcgacaagacg
gtcgatgggctgaagaccggccacaccgaggaggccggctactgcctggtagcctccgcg
gtgcgcgatggcatgcgtctgatttccgtggtgttcggcactgccagcgagcaggcccgc
gccgccgaaactcagaagctgctgacctacggtttccgcttcttcgagacccgtaccttc
tatgagaagggtgtcgagctggcgcagcccaaggtctggaaaggccagcaggacaaggtg
gctgccggccttgccaaggacctgacgctcaccttgccgcgcgggcagttggacaagctg
gaagccggcatgaccttcaaatccaacctcatcgcgccgatccagcagggcgacgtgatc
ggtacggtcgaggtcaagctcgaggacaaggtgctgcacagcaccgacctgatcgctctg
caaagcgtggaagagggtgggctgttccggcggttctgggatagcattcgcctgttcttc
ttcggcctgttcaactga

DBGET integrated database retrieval system