KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_17310Help
Entry
PSJM300_17310     CDS       T02182                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
psj  Pseudomonas stutzeri DSM 10701
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AFN79517
LinkDB All DBs
Position
3759052..3760128
Genome map
AA seq 358 aa AA seqDB search
MAMMKAAVFVEPGRIELQDKPIPEIGPNDALLRITTTTICGTDVHILKGEYPVAAGLTIG
HEPVGIIEKLGSNVQGYQEGQRVIAGAICPSFTSYACQDGVASQDGGACSCHGYKPMGGW
RFGNTIDGTQAEYVLVPDAQANLAPVPDGLTDEQVLMCPDIMSTGFGGAEKADIRIGDIV
AIFAQGPIGLCATAGARLRGASCIIVIDGVEERLAISRQMGADVTLNFRDVDVVEEILKI
TGGRGVDAAIEALGTQTTFEQALRVLKPGGTLSSLGVYSQDLKIPLGALHAGLGDHRIIT
SLCPGGKERMRRLLNVVASGRVDFGALVTHQYKLDAITEAYDLFANQRDGVLKVAIKP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccatgatgaaagccgccgtgttcgtcgaacccggcagaatcgagctacaggacaag
cccatccccgagatcggccccaacgacgcgctgctgcgcatcaccacgaccaccatctgc
ggcaccgacgtgcacatcctcaagggtgagtacccggtggcggcaggcctgaccatcggt
catgaaccggtgggcatcatcgagaagctcggcagcaacgtgcagggctaccaggaaggc
cagcgcgtgatcgccggtgccatctgtcccagcttcacctcctacgcctgccaggacggc
gttgcctcccaggatggcggcgcctgcagctgccacggctacaagccgatgggcggctgg
cgcttcggcaacaccatcgacggcacccaggccgaatacgtgctggtaccggatgcccag
gcgaacctggcgccggtaccggacggcctgacggacgaacaggtgctgatgtgccccgac
atcatgtccaccggttttggcggcgcggaaaaagccgacatcaggatcggcgacatcgtc
gcgatcttcgcccaaggtccgatcggtctctgcgcgacggcaggtgccaggttgcgtggg
gccagctgcatcatcgtcatcgacggggtcgaggaacgcctggccatctcccggcagatg
ggggccgacgtgacgctgaatttccgcgatgtggacgtggtcgaggaaatcctcaagatc
accggcggccgcggcgtggatgcggcaatcgaggcgctgggcacccagaccaccttcgag
caagcgctgcgcgtcctcaagcccgggggcacgctgtcgagtctgggcgtctactcccag
gacctgaagattccgctgggcgccctgcatgccggcctcggcgaccatcggatcatcacc
tcgctatgccccggcggcaaggaacgcatgcggcgcctgctcaatgtggtcgcctccggc
cgcgtcgacttcggcgcgctggtcacccaccagtacaagctggacgccatcaccgaggcc
tacgacctgttcgccaaccagcgcgatggcgtgttgaaggtggcgatcaagccctaa

DBGET integrated database retrieval system