KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_18570Help
Entry
PSJM300_18570     CDS       T02182                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase II
  KO
K03781  catalase [EC:1.11.1.6]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00380  Tryptophan metabolism
psj00630  Glyoxylate and dicarboxylate metabolism
psj01110  Biosynthesis of secondary metabolites
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSJM300_18570 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    PSJM300_18570 (katE)
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PSJM300_18570 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AFN79767
LinkDB All DBs
Position
complement(4019196..4021331)
Genome map
AA seq 711 aa AA seqDB search
MTDINPPRNEVAGTDTPDRANRNAKLDQLESFRSDATDQALTTNQGVKIADNQNTLRAGD
RGPSLLEDFIMREKITHFDHERIPERIVHARGAAAHGVFTSYGDHSWLTKASFLAAEGKE
TPVFVRFSTVQGSRGSADTVRDVRGFATKFYTDEGNFDLVGNNMPVFFIQDAIKFPDFVH
AVKPEPHNEIPQAQSAHDTFWDFVSLTPESAHMVLWTMSDRAIPRSYRAMEGFGVHTFRM
INAEGKSRFVKFHWKPVAGAFSLLWDETLKLAGKDPDFNRRDMWESIESGDPFEWELGVQ
VVEEEDEHSFDFDLLDPTKIIPEELVPVQTLGKMTLNRNPDNFFAETEQAAFHIGHIVPG
IDFTNDPLLQGRLFSYTDTQLLRLGGPNFHEIPINRPLCPFHNNQRDAFHRQAIHKGRAN
YEPNSIDGGWPKETPPAASGGGFESYPERVEGHKIRNRSASFGDHFSQATLFWNSMSAPE
KEHIVGAYTFELGKVERVFIRERQVNEILANIDLELARRVAENLGLPAPSAPSVAKKEPA
TPSSPALSLMNHLPGNIKSRKVAVLVADGVDGAAIDAFKAKLAEEGAMIKLIGPTPAPVI
TAEGQKLVIDGPMDGLPSILFDALFVPGGAQAVALLEKSGDARHYLLEAYKHLKPIAVLG
DARRMLAPLQLQADAGLLEGDSVDAVFDPFVQALAQHRIWAREAAAKAVPA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcaaccctccacgcaacgaagtggccggcaccgacacccccgaccgcgcc
aaccgcaacgccaagctcgaccagctggagagcttccgcagcgacgccaccgatcaggca
ttgaccaccaaccagggcgtgaagatcgccgacaatcagaacacgctcagggccggcgac
cggggcccctcgctgctcgaagacttcatcatgcgcgagaagatcacccacttcgaccac
gagcgcatccccgaacgtatcgtccatgcccgaggcgccgcggcccatggcgtgtttacc
agctacggcgaccacagctggctgaccaaggcttccttcctcgccgccgagggcaaggag
acgccggtattcgtgcgcttctccaccgtgcagggttcgcgcggttcggcggatacggtg
cgtgacgtgcgcggcttcgccaccaagttctataccgacgaaggcaacttcgacctggtg
ggcaacaacatgccggtgtttttcatccaggacgcgatcaagttccccgacttcgtccac
gcggtcaaacccgagccgcacaacgagattccccaagcgcagtcggcccacgacaccttc
tgggatttcgtctcgctgacgccggagtcggcgcacatggtgctctggaccatgtccgac
cgcgccattccgcgttcctaccgggccatggagggcttcggcgtgcacaccttccgcatg
atcaatgccgagggcaagagccgcttcgtcaagtttcactggaagccagtggccggggcc
ttttccctgctctgggacgagactctcaagctggccggcaaggacccggacttcaaccgc
cgcgacatgtgggagtctatcgagagcggcgatcccttcgagtgggagctgggggtgcag
gtggtggaggaagaggacgagcacagcttcgacttcgacctgctggacccgaccaagatc
atccccgaggaactggtgccggtgcagacgctcggcaagatgaccttgaaccgcaacccg
gacaacttcttcgccgagaccgaacaggcggccttccatatcggccatatcgtgccgggc
atcgacttcaccaacgaccccttgctgcagggccggctgttttcctacaccgacacccag
ctgctgcgcctgggcggaccgaacttccacgagatcccgatcaaccggccgctgtgcccc
ttccacaacaaccagcgcgatgccttccatcggcaggccatccacaagggccgcgccaac
tacgagcccaactccatcgacggcggctggcccaaggagacgccgccggccgccagcggt
ggtggcttcgagagctatccggagcgggtcgaggggcacaagatccgcaaccgcagcgcg
tccttcggcgatcatttctcccaggccacgctgttctggaacagcatgagcgcgccggag
aaggagcacatcgtcggcgcctacaccttcgagctgggcaaggtcgagcgggtgttcatc
cgtgagaggcaggtcaacgagatcctcgccaacatcgatctggaactggcccgacgagtg
gcggaaaacctcggcctgccggcgccgagtgcgcccagcgtggcgaagaaggagccggcg
acgcccagctcgccggcgctgagcctgatgaaccatctgccgggcaacatcaagtcgcgc
aaggtggcggtgctggtggccgatggcgtggacggcgcggccatcgatgccttcaaggcg
aaactggccgaggagggcgcgatgatcaagctgatcggcccgactccggcgccggtgatc
accgccgaaggccagaagctggtcatcgacggccccatggatggcctgccctcgatcctc
ttcgacgccctgttcgtgcccggtggcgcccaggcggtggcgctgctggagaaatccggt
gatgcccgccattacctgctggaagcctacaagcacctcaagcccatcgcggtgctgggc
gatgcccggcggatgctggcgccgctccagttgcaggccgatgccggcttgctggaaggc
gattcggtggatgcagtgttcgaccccttcgtccaggcgctggcgcagcatcgcatctgg
gccagggaggcggcagcgaaggcggtgccggcgtag

DBGET integrated database retrieval system