KEGG   Pseudomonas sp. TKP: U771_04682
Entry
U771_04682        CDS       T02969                                 

Definition
(GenBank) type III effector Hop protein
Organism
psk  Pseudomonas sp. TKP
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: AHC33487
LinkDB
Position
complement(1036959..1037312)
AA seq 117 aa
MIQYPRLTALTCRLALPGLIALFGCGLPVSHATAASASEQANLDVMIRQLNALEDTARRS
AQVADEPGKRYFFDYQRLAGDIARIRHGLEGYLTPTRAQPRDPVELSGQYTTEGRKP
NT seq 354 nt   +upstreamnt  +downstreamnt
gtgatccagtacccgcgtctcactgcactcacttgccgacttgccttgccaggcctcatc
gcactttttggatgcggcctgcctgtctctcatgcgaccgctgcttcagcctccgaacag
gccaacctggacgtgatgatccgccagttgaatgccttagaggacaccgcacgtcgtagc
gctcaagtggccgacgaacctggcaagcgttacttcttcgattaccagcgtctagcaggt
gatatcgctcgaattcgtcatgggttggagggctatctaaccccaacccgagcccagcct
cgtgatcctgttgagctgtcaggccaatacacgaccgaaggacgcaagccatga

DBGET integrated database retrieval system