KEGG   Pseudomonas sp. TKP: U771_05920Help
Entry
U771_05920        CDS       T02969                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00473  D-Alanine metabolism
psk00550  Peptidoglycan biosynthesis
psk01100  Metabolic pathways
psk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    U771_05920
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    U771_05920
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    U771_05920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psk01011]
    U771_05920
Enzymes [BR:psk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     U771_05920
Peptidoglycan biosynthesis and degradation proteins [BR:psk01011]
 Precursor biosynthesis
  Amino acid ligase
   U771_05920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK ATP-grasp_5 ATPgrasp_YheCD TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AHC33731
UniProt: V9QS72
LinkDB All DBs
Position
1294365..1295321
Genome map
AA seq 318 aa AA seqDB search
MTVNYDALFSTIAPADFGRVAVLFGGKSAEREVSLKSGNAVLEALQSAGVNAFGIDVGDD
FLARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHSVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDAT
KEQELMDLTAKACEALGIAGWARADVMQDDQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASIEARG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaattacgacgccctgttctctaccatcgcgcctgccgacttcggccgcgtg
gcggtattgttcggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcaatgcc
gtgcttgaagccctgcaaagcgccggcgtgaatgcgttcgggatcgacgtgggcgatgac
ttcctcgcccgcctgcaggccgagaagatcgaccgcgcctttatcatcctgcacggtcgt
ggcggtgaagatggcagcatgcagggcctgctggagtgcgcaggcattccttacaccggc
agcggtatcctggcttccgcgctggcgatggacaagttgcgcaccaagcaggtgtggcac
agcctgggtattccaaccccgcgccacagtgtcctgtgcagcgaagacgattgtatttcc
gcagccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggccaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgattcgcaagtgttggtggaacagtggatccagggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccgcccatcgcattgggcacgccccacaccttttacgactac
gacgccaagtacctggcttccgatacccagtaccggatcccgtgcggccttgacgcaacc
aaagaacaggaattgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tgggcgcgggcagacgtgatgcaggatgaccaagggaatttctggttcctggaagtcaac
accgcaccgggtatgaccgaccacagcctggtccctatggccgctcgcgccgccggtctg
gatttccagcagttggtgctggccattctcgcagcaagcattgaggctcgaggctaa

DBGET integrated database retrieval system