KEGG   Pseudomonas sp. TKP: U771_07355Help
Entry
U771_07355        CDS       T02969                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00620  Pyruvate metabolism
psk00680  Methane metabolism
psk01100  Metabolic pathways
psk01120  Microbial metabolism in diverse environments
psk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    U771_07355
  09102 Energy metabolism
   00680 Methane metabolism
    U771_07355
Enzymes [BR:psk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     U771_07355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHC34017
LinkDB All DBs
Position
1605339..1607984
Genome map
AA seq 881 aa AA seqDB search
MSDIDARLREDVHLLGELLGNTIREQYGDDFLAKIEQIRKGAKADRRGAVSDKTAGDELS
SSLNQLQEDELLPVARAFNQFLNLANIAEQYQLIHRRDESQPAPFEARVLPELLARLQRE
GHSNESLARQLGRLEIELVLTAHPTEVARRTLIQKYDAIAAQLALQDHRDLTTAEREQIR
ERLQRLIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPNYLRKADHALHAATGLH
LPLEAAPIRFASWMGGDRDGNPNVTAPVTREVLLLARWMAADLYLRDIDQLASELSMQHA
SPALQAKVGDSVEPYRALLKQLRDRLRATRSWAQASLTVATPASADVLQHNRDLLEPLEL
CYQSLHECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHTAAMTEITDYLGLGRY
EDWNEEMRISFLMKELANRRPLLPGYFKPSADTAEVLNTCKEVAAAPAASLGSYVISMAG
AASDVLAVQLLLKESGVQRPMRVVPLFETLADLDNAGPVIEQLLLLPGYRARLQGPQEVM
IGYSDSAKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILS
QPPGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPAWRHLMD
ELAADGVSAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIF
GWTQTRLMLPAWLGWEAALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIA
RLYDERLVQPDLLPLGAHLRDLLSQACQVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPL
HLLQAELLARSRQQEAAQDSPLEQALLVSVAGIAAGLRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatatcgatgcacgcttgcgcgaggatgttcacctgctgggtgagctgttgggc
aataccattcgagagcagtacggcgatgattttctcgccaagatcgagcagatccgcaaa
ggagccaaggctgaccggcgcggcgccgtctcggataaaacggctggcgatgaactgagc
agcagcttgaaccagttgcaggaagacgaactgctgcccgtcgcccgggccttcaaccag
ttccttaacctggccaatattgccgagcagtaccaattgattcatcggcgcgatgagtcg
caaccggcgcccttcgaagcacgcgtattgccggagttgctggcccgcctgcaacgcgaa
ggccacagcaacgagtcgctggcccgccaattggggcgcctggaaatcgagctggtgctc
accgcccaccccactgaagtggcgcggcgcaccctgatccagaaatacgatgcgatcgcc
gcgcaactggcgctgcaggatcaccgcgacctcaccacggccgagcgcgagcagatccgc
gagcgcctgcagcggttgatcgccgaagcctggcacaccgaagaaatccgccgtacccgg
cccactccggtggacgaggccaaatggggttttgcggtgatcgagcattcgctttggcat
gcgatccccaattacctgcgcaaggccgaccatgcgctgcatgcggctaccggcctgcac
ttgccactggaagccgcgccgatccgctttgcgtcctggatgggcggcgaccgtgacggt
aacccgaatgtcaccgcgccggtcacccgtgaagtgctattgctggcccgctggatggcc
gccgacctgtatctgcgcgatatcgatcaattggcctcggaactgtcgatgcagcacgcc
agcccggcgttgcaagccaaggtcggtgacagcgtcgaaccctatcgggcgttactcaag
caactgcgtgaccgcttgcgcgcgacccgcagttgggcccaggcctcgctgactgtcgcc
accccggcgagcgcagacgtgttgcaacacaaccgtgacctgctcgagccgctggagctt
tgttaccagtcgctgcatgagtgcggcatgggcgtgattgccgatggcccattgctcgat
tgcctgcgtcgtgcggtcaccttcggcctgttcctggtccgcctggacgtgcgccaggac
tccagtcggcatacggcggccatgaccgagatcaccgattacctcggcctgggtcgttat
gaagactggaatgaggagatgcgcatcagcttcctcatgaaagagctggccaaccgtcgc
cccctgttgccgggctatttcaagccgtcggcggacacggccgaagtgttgaatacctgc
aaggaagtcgccgccgcaccggccgcttccctgggttcgtacgtcatctccatggccggg
gccgcctcggatgtgctggcggtgcaactgttgcttaaagagtcgggcgtgcaacggccg
atgcgggtggtgccgctgttcgaaaccctggccgacctggataacgcgggcccggtgatc
gagcaactgttgctgttgccgggttaccgcgcacggttgcagggcccgcaggaagtcatg
atcggttactcggactcagccaaggatgccggcaccactgccgctgcctgggcgcagtac
cgtgcccaggaacgcttggtggatatctgccgtgagcaacaggtggaactgctgttgttc
cacggtcgcggtggcaccgtgggccgtggcggcggcccggcccacgcggcgatcctgtcg
cagccaccggggtcggtggcggggcgtttccgtaccaccgaacaaggggaaatgatccgt
ttcaaattcggcctcccagacattgccgagcagaacctcaatctctatctggctgccgtg
ttggaagcgacgctgctgccaccgccgccaccggagcctgcgtggcggcatttgatggat
gaattggcggcagacggtgtcagcgcctatcgcgccgtagtgcgggaaaatccgcagttc
gtcgagtacttccgccagtcgacgccggagcaggaactcggtcgcttgcctctgggcagc
cgcccggccaagcgccgtgccggtggtattgaaagcctgcgggcgattccgtggatcttt
ggctggacccagacccgcctgatgttgcccgcctggctgggctgggaagcggccctgagc
aaggcgctggagcgtggcgaaggcgaactgctggggcaaatgcgcgagcagtggccgttc
ttccgcacccgcatcgatatgttggaaatggtgctggccaaggccgatgccgacatcgcg
cggctgtatgacgagcgcctggtgcagccggacctgctgccattgggtgcgcatttacgc
gacctattgtcgcaggcgtgccaggtggtacttggcctgactggccagtcgcaactgctg
gcgcatagccccgacaccctggagttcatccgcctgcgcaatacctacctggaccctttg
cacctgttgcaggccgaactgctggcacgctcccgtcaacaggaagcggcgcaggacagc
cctctggaacaagcgctgctggtgtccgtggccggtatcgccgccgggttgcgtaacacc
ggctga

DBGET integrated database retrieval system