KEGG   Pseudomonas sp. TKP: U771_09725Help
Entry
U771_09725        CDS       T02969                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00220  Arginine biosynthesis
psk00250  Alanine, aspartate and glutamate metabolism
psk00290  Valine, leucine and isoleucine biosynthesis
psk01100  Metabolic pathways
psk01110  Biosynthesis of secondary metabolites
psk01130  Biosynthesis of antibiotics
psk01210  2-Oxocarboxylic acid metabolism
psk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U771_09725
   00290 Valine, leucine and isoleucine biosynthesis
    U771_09725
   00220 Arginine biosynthesis
    U771_09725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psk01007]
    U771_09725
Enzymes [BR:psk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     U771_09725
    2.6.1.66  valine---pyruvate transaminase
     U771_09725
Amino acid related enzymes [BR:psk01007]
 Aminotransferase (transaminase)
  Class I
   U771_09725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Costars
Motif
Other DBs
NCBI-ProteinID: AHC34488
LinkDB All DBs
Position
complement(2099925..2101136)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLVPAPDYPLWTAAVTLAGGHPVHYLCDEGADWFPDLADIKAKITPNTKALVIINPNNPT
GAVYSREVLQGMLELARQHNLVVFSDEIYDKILYDDAVHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWIAISGPKHNAQSYIEGIDMLANMRLCANVPSQHAIQTALGGYQSINDLVL
PQGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFVLDLLLSEKL
LVVQGTAFNWPWPDHFRVVTLPRVDDLEMAIGRIGNFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctacgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccatcgcatcctcaagctgaacattggc
aacccggcgccctttggtttcgaagcaccggacgaaattctccaggatgtgatccgcaac
ctgcccaccgcccaaggctacagcgactccaagggactgttcagtgcgcgcaaggcggtc
atgcagtactaccagcagaagcaggtcgaaggtgttggcattgaagacatctacctgggc
aatggcgtgtccgagctgatcgtgatgtcgatgcaggccttgctcaacaacggcgacgaa
gtgctggtgccagcgcccgactacccgctgtggaccgctgcggtgaccctggccggtggc
catccggtgcattacctgtgcgacgagggcgccgactggttcccggacctggccgacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaaccccact
ggcgcggtgtactccagggaagtgttgcagggcatgctcgaactcgcacgccaacacaac
ctggtagtgttctccgacgagatctacgacaagatcctctacgacgacgccgtgcatatc
tgcaccgcgtccctggcgccggacctgctgtgcctgaccttcaatggcctgtccaagtcc
tatcgcgtggcgggcttccgctccggctggatcgccatctccggtcccaagcacaatgcc
cagagctacatcgaaggcatcgatatgctggccaatatgcgcctgtgcgccaacgtaccg
agccagcatgcgatccagacggcgctgggtggctaccagagcatcaacgacctggtattg
ccccagggccgcctgcttgaacagcgcaaccgcacctgggaactgctcaacgatatccca
ggagtcagttgcgtgaagccaatgggcgcgctgtatgccttcccgcggatcgacccgaag
gtctgcccgattctcaacgacgagaagttcgtactcgacctgctgctgtcggaaaagctg
ctggtggtgcaaggcacagcgttcaactggccgtggccggatcacttccgcgtggtgacc
ttgccgcgtgtggatgacctggaaatggccattggtcgtatcggcaacttcctcaagtcc
tatcgccagtaa

DBGET integrated database retrieval system