KEGG   Pseudomonas sp. TKP: U771_09725Help
Entry
U771_09725        CDS       T02969                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00290  Valine, leucine and isoleucine biosynthesis
psk01100  Metabolic pathways
psk01110  Biosynthesis of secondary metabolites
psk01130  Biosynthesis of antibiotics
psk01210  2-Oxocarboxylic acid metabolism
psk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U771_09725
   00290 Valine, leucine and isoleucine biosynthesis
    U771_09725
   00220 Arginine biosynthesis
    U771_09725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psk01007]
    U771_09725
Enzymes [BR:psk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     U771_09725
    2.6.1.66  valine---pyruvate transaminase
     U771_09725
Amino acid related enzymes [BR:psk01007]
 Aminotransferase (transaminase)
  Class I
   U771_09725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Costars
Motif
Other DBs
NCBI-ProteinID: AHC34488
LinkDB All DBs
Position
complement(2099925..2101136)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLVPAPDYPLWTAAVTLAGGHPVHYLCDEGADWFPDLADIKAKITPNTKALVIINPNNPT
GAVYSREVLQGMLELARQHNLVVFSDEIYDKILYDDAVHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWIAISGPKHNAQSYIEGIDMLANMRLCANVPSQHAIQTALGGYQSINDLVL
PQGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFVLDLLLSEKL
LVVQGTAFNWPWPDHFRVVTLPRVDDLEMAIGRIGNFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctacgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccatcgcatcctcaagctgaacattggc
aacccggcgccctttggtttcgaagcaccggacgaaattctccaggatgtgatccgcaac
ctgcccaccgcccaaggctacagcgactccaagggactgttcagtgcgcgcaaggcggtc
atgcagtactaccagcagaagcaggtcgaaggtgttggcattgaagacatctacctgggc
aatggcgtgtccgagctgatcgtgatgtcgatgcaggccttgctcaacaacggcgacgaa
gtgctggtgccagcgcccgactacccgctgtggaccgctgcggtgaccctggccggtggc
catccggtgcattacctgtgcgacgagggcgccgactggttcccggacctggccgacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaaccccact
ggcgcggtgtactccagggaagtgttgcagggcatgctcgaactcgcacgccaacacaac
ctggtagtgttctccgacgagatctacgacaagatcctctacgacgacgccgtgcatatc
tgcaccgcgtccctggcgccggacctgctgtgcctgaccttcaatggcctgtccaagtcc
tatcgcgtggcgggcttccgctccggctggatcgccatctccggtcccaagcacaatgcc
cagagctacatcgaaggcatcgatatgctggccaatatgcgcctgtgcgccaacgtaccg
agccagcatgcgatccagacggcgctgggtggctaccagagcatcaacgacctggtattg
ccccagggccgcctgcttgaacagcgcaaccgcacctgggaactgctcaacgatatccca
ggagtcagttgcgtgaagccaatgggcgcgctgtatgccttcccgcggatcgacccgaag
gtctgcccgattctcaacgacgagaagttcgtactcgacctgctgctgtcggaaaagctg
ctggtggtgcaaggcacagcgttcaactggccgtggccggatcacttccgcgtggtgacc
ttgccgcgtgtggatgacctggaaatggccattggtcgtatcggcaacttcctcaagtcc
tatcgccagtaa

DBGET integrated database retrieval system