KEGG   Pseudomonas sp. TKP: U771_11255Help
Entry
U771_11255        CDS       T02969                                 

Definition
(GenBank) MFS transporter
Organism
psk  Pseudomonas sp. TKP
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_2
Motif
Other DBs
NCBI-ProteinID: AHC34780
LinkDB All DBs
Position
2418208..2419401
Genome map
AA seq 397 aa AA seqDB search
MLATIRNYPRTVNLLLSATLMLTLAKAITFPYLVIYLTSHFALDISQVGLVIGSSLIVGS
LLSVYGGFLVDRINSYRLLLGLSVLFALGFVGTVLAQNIWTFYSCLILINLAYAVIDIAV
KAGFASLLPEEARSEVFSIKYTLTNIGYAVGPWFGAMVAKLDISLPFILSALLGVGFFLL
YWRWGDRSLATADAMQKPVSFLAVGGVLLRDHRLVCFTLGGLLSAVVFGQFTAYLSQYLV
TTTTAEYTYTVISAVLTTNAVLVIALQYVIGRRISHRHLSRWLIFGLSMFMLGLIGFALS
TSVWWWVLAMAVFTIGEIIVFPAEYMFIDRIAPDHLRGMYYGAQNLSNLGAALGPVLCGL
VLASLPAHYMFYMLGAFIVAGGVFYFIGSSLKASHRS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccacaataagaaactacccccgcaccgtgaacctgctgctgtcggctaccttg
atgctgacgctggccaaagccatcaccttcccctacctcgtgatctacctgaccagccac
tttgcactggacatcagccaggtcggcctggtcatcggcagttcgctgattgtcggttcg
ctgctcagcgtctatggcgggtttctggtcgatcgcatcaacagctatcggctgttgctc
gggttgagcgtgctatttgcgctgggctttgtcggcacggtactcgcgcagaatatctgg
acgttctacagctgcctgatcctgatcaaccttgcttatgcggtgatcgacattgccgtc
aaggccggtttcgccagcctgttgccggaagaggcgcgcagtgaagtgttttccatcaag
tacaccctgaccaatatcggctatgcggtggggccgtggtttggcgcgatggtggccaag
ctggatatcagcctgccgttcattctgtcggccctgttgggggtggggtttttcctgctg
tactggcgctggggtgatcgctcactggctaccgccgatgcgatgcaaaaaccggtgtca
ttcctggccgttggcggcgtgctgctgcgcgaccatcgcctggtgtgtttcaccctgggc
ggcctgctcagtgcggtggtgttcggccagttcaccgcgtacctgtcgcagtacctggtg
accaccaccacggcggaatatacctacaccgtgatcagcgccgtactcaccaccaatgcc
gtgctggtgattgccttgcaatatgtgatcggccgacgtatttcccaccgtcacctgagc
cgctggctgatcttcggcctgagcatgttcatgctgggcttgatcggtttcgcgctgtcc
accagcgtgtggtggtgggtgctggcgatggcggtgttcaccattggggaaatcatcgtg
ttcccggccgagtatatgtttatcgatcggattgccccggaccacctgcggggcatgtac
tacggtgcgcagaacctgtcgaacctcggtgccgccctggggccggtattgtgtgggctg
gtgctggccagcctgccggcacactacatgttctacatgctcggtgcgtttatcgtcgcg
ggcggggtgttctatttcattggttcgtcgttgaaggcaagtcatcgatcatga

DBGET integrated database retrieval system