KEGG   Pseudomonas sp. TKP: U771_11590Help
Entry
U771_11590        CDS       T02969                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00250  Alanine, aspartate and glutamate metabolism
psk00280  Valine, leucine and isoleucine degradation
psk00410  beta-Alanine metabolism
psk00640  Propanoate metabolism
psk00650  Butanoate metabolism
psk01100  Metabolic pathways
psk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    U771_11590
   00650 Butanoate metabolism
    U771_11590
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U771_11590
   00280 Valine, leucine and isoleucine degradation
    U771_11590
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    U771_11590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psk01007]
    U771_11590
Enzymes [BR:psk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     U771_11590
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     U771_11590
Amino acid related enzymes [BR:psk01007]
 Aminotransferase (transaminase)
  Class III
   U771_11590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHC34846
LinkDB All DBs
Position
complement(2490333..2491619)
Genome map
AA seq 428 aa AA seqDB search
MNSALTENQRLLALREQHVPRGIATAHPVVAARAQGAELWDVDGKRYLDFVGGIGVLNVG
HNHPKVVEAVRRQVGEISHASFQVVAYENYIQVAARLNKLIGGDAHYKSVLFTSGAEAVE
NAVKIARGYTNRTAVISFRGGFHGRTLLGVTLTGMSQPYKQNFGPFPAEIYHATYPNAYR
GVSSDDALAELDELFATDVAPDRVAAIIIEPVQGDGGFLAAPKEFLQALRARCTQHGIVL
ILDEIQAGFGRTGTMFGFQHADIQPDLVTVAKSLAGGMPLSGVVGRAEIMDAPTPGGLGG
TYGGNAVACAAALAVLDLFEEQDLLAQGETLAAQLHDGLLALQKRYPRIGDVRGLGFMQA
IEMIADDAARSPDAALAQKVIDEARNAGLLVIKCGVHRNVVRFLAPLVTTPEQVAEALQM
LDKALAAC
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgcactgactgaaaaccaacgcctgctggccctgcgcgaacagcatgtaccg
cgtggtatcgccaccgcccacccggtggtcgcggcgcgcgcgcagggcgccgaactgtgg
gatgtcgatggcaagcgttacctggacttcgtcggcggcatcggcgtgctcaacgtcggc
cataaccatccgaaggtggtcgaggcggtgcgtcggcaggtcggcgagatctcccatgcc
agcttccaggtggtggcctacgaaaactacattcaggtcgccgcgcgcctgaacaaactg
atcggcggcgacgcccactacaaaagcgtgctgttcacgtccggtgccgaagccgtcgaa
aacgcggtgaagatcgcccgtggctacaccaatcgcaccgcggttatttccttccgcggt
ggcttccacggccgtaccctgctgggcgtgaccctgaccggcatgagccagccctacaag
cagaacttcggccccttccccgccgagatctatcacgccacctaccccaacgcctatcgc
ggcgtcagcagcgatgatgcgctggccgagctggacgagctgttcgccaccgacgtggcg
ccggaccgtgtcgccgcgatcatcatcgaaccggtccagggcgatggcggcttccttgcg
gcccccaaagaattcctgcaagccctgcgcgcccgctgcacccagcacggcatcgtgctg
atcctcgatgagatccaggcgggcttcggccgtaccggcacgatgttcggcttccagcat
gccgacatccagcccgacctggtgaccgtcgccaagagcctggccggcggcatgccactg
tctggcgtggtcggtcgcgccgagataatggacgcaccgacgccgggcggcctgggcggc
acctatggtggcaacgcagtagcttgtgctgcggcactggccgtgctggacctgttcgaa
gagcaggatctgctggcacagggcgagacactggcagcccaactgcatgacgggttgctg
gccttgcagaaacgttacccgagaatcggtgacgtgcgcggcctgggcttcatgcaggcg
atcgaaatgatcgccgacgatgccgcccgtagccccgatgcagcactggcgcaaaaggtc
atcgatgaagcccgaaacgccggtttgctggtgatcaagtgcggtgtacatcgcaacgta
gtgcgtttcctcgcgccgctggtgaccactccagagcaagtggcagaagccttgcagatg
ctcgacaaagcgttggccgcctgctga

DBGET integrated database retrieval system