KEGG   Pseudomonas sp. TKP: U771_12560Help
Entry
U771_12560        CDS       T02969                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00010  Glycolysis / Gluconeogenesis
psk00052  Galactose metabolism
psk01100  Metabolic pathways
psk01110  Biosynthesis of secondary metabolites
psk01120  Microbial metabolism in diverse environments
psk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U771_12560
   00052 Galactose metabolism
    U771_12560
Enzymes [BR:psk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     U771_12560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHC35036
UniProt: V9QVY4
LinkDB All DBs
Position
complement(2717659..2718807)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLALSMMIASGGAQAAGLSSEQKPFGKTNDGTAVEQYILRNSHGMQATVIT
YGGVLQSLKVPDKHGKLDDVVLGFDDVQGYQAGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKQVWKAEPVKDKDSVGVKLSYLSKDGEMGFPGNLKTEVTYR
LNDQNELHIDYTATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGELAPVKGTPMDFLKPTPIGQHIKDDHPQLKFAEPKQGGFDFNWALDTQGNIKQLAAEV
HDPASGRRLQLYTTEPGVQFYTSNFLDGSVKGKGGKTYLHWSGFTLETQHFPDAPNQPKF
ASTRLDPGQTYRQNTVFKFSAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgatacctgctgtccggcctggcgctgtccatgatgatcgccagcggt
ggcgcccaggcagccggtttgtccagcgagcaaaaacctttcggtaaaaccaacgacggc
accgccgtcgagcagtacatcttgcgcaacagccatggcatgcaagccacggtgatcact
tacggcggtgtgctgcagtcgctgaaggtgccggacaaacacggcaagctcgacgacgtg
gtcctgggctttgacgacgtacagggctaccaggccggcacggcgtttttcggcgcgacc
atcgggcgctttggcaatcgcctggcgggcggcgcctttgagctcgacggcaagcgctac
caggtgccactcaacgacggtcccaattcgctgcatggcggcgcccagggtttcgacaag
caggtgtggaaagccgagccggtcaaggataaggattccgtcggtgtgaagctgagctac
ctgtccaaggacggtgaaatgggattccctggcaacctgaaaaccgaggtcacctatcgt
ctcaatgaccagaatgaactgcatatcgactacaccgccaccaccgacaaacccacggtg
cttaacctcactaaccacagctatttcaacctggccggcgcggggaatggcgacatcctc
aagcaggtcgcgaccttgcatgccagccactacacgccagtcaacgccaccttgattccc
acgggcgaactggcgccggtcaaaggcacgccaatggatttcctgaaacctacgcctatc
ggccagcacatcaaggatgaccatccgcagctcaaatttgccgagcccaaacagggcggg
tttgatttcaactgggcgctggacacccaaggcaatatcaaacaactcgccgccgaggta
cacgaccccgcctccggacggcgcttgcagttgtacaccaccgagcctggggtgcagttc
tataccagcaacttcctcgacggttcggtaaagggcaagggcggcaagacctacctgcac
tggagtggcttcaccctggaaacccagcacttcccggatgcgccgaaccagcccaagttt
gcgtcaacccgcctggaccccgggcagacttatcggcagaacaccgtcttcaagttctcc
gctgactga

DBGET integrated database retrieval system