KEGG   Pseudomonas sp. TKP: U771_22845Help
Entry
U771_22845        CDS       T02969                                 

Definition
(GenBank) peptide synthase
Organism
psk  Pseudomonas sp. TKP
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AHC37060
UniProt: V9R0X5
LinkDB All DBs
Position
complement(5033708..5046592)
Genome map
AA seq 4294 aa AA seqDB search
MDAFELPRTLVQSLQQRAEQTPDQVALRFLAESAEQSIVLSYRDLDLRARTIAAALQANA
ALGERAVLLFPSGPDYVAAFFGCLYAGIIAVPAYPPESTRRHHQARLLSIIADAEPRLLL
TIASLGDGLAQLENAPPVLSVDTLDAQIADSWRAPDLQPDDIAFLQYTSGSTALPKGVQV
SHGNLVANEVLIRRGFGIDVNPDDVIVSWLPLYHDMGLIGGLLQPVFSGVPCVLMSPAYF
LGRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALARLDLSQWRVAYSGSEPIRLDT
LERFAEKFARCGFTANSFFASYGLAEATLFVAGGRRGQGIPALRVDEQALAANRAEPGQG
SAIMSCGTSQPDHGVLIVDPHTLSELADNGVGEIWASGPSIAHGYWRNPEASAKTFVQHA
GRTWLRTGDLGFIREGELYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAFA
VNDQGQEGIGIAAEISRSVQKILPPEALIKAIRQAVAEAYQEAPCVVLLLNPGALPKTSS
GKLQRAACAVRHADGSLDSYAQFPDLHAPAPNAAQGSELQSRIAAIWCEQLHVASVAADD
HFFLLGGNSITATQVVARLREDLGLELNLRMLFEAPTLEGFAAHIAQLQQDGGVAQGAIH
TLSRDEDLPQSLAQNRLWITWQLDPLSSAYTIPGALRLRGELDEDAVRASFQHLIQRHEA
LRTRFYERDGQAFQRVDANSDFDLHVIDLSHLPAAERDARAQQIREDEARTQFDLENGPL
LRVTLVRLEDEDHQLLVTLHHIIADGWSLNLLIDEFSRLYAAAAQGQTLALPPLALQYAD
YASWQRQWLAEGEGQRQLAYWKAQLGEEHPALSLATDHPRSAQQRHTASRHSVRLGASLS
EAIRQTAQSHESTPFMLLLAAFQTLLYRYSGQRDIRIGVPNANRPRQETQGLVGFFINTL
VLRAELDGRLPFNQLLAATRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQRD
LSALRRLPGMLADELPWHSREAKFDLQLHTEEDRNGRLGLSFDYADELFEPATIQRLAEH
FIHLLHAICEHPQRALGDLKLMQQDEQQAWSQAPCAPAQQWLPELLNPSVSDSTALVWQD
GSLTFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGGAYVPLDPD
YPAERLAYMLRDSRAHLLLTQTALLEHLPTADGVCVIAMDSLHLDSWPTQPPGLHLEGDN
LAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYQLNHTDVLMQKAPISFDVSVWECFW
PLITGCRLVLAGPGEHRDPHRIAQLVQEHGVTTLHFVPPLLQLFIDEPLVAECTSLRRLF
SGGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCRVEDGERSPIGRPLGNVIC
RVLDEQLNPVPVGVPGELCIGGIGLARGYLGRPGLTAERFVADHQGARLYRTGDRARWSA
DGVLEYLGRLDQQVKLRGFRVEPEEIEARLLALDGIAQAVVLVRDAQLIGYYTAHAELDE
QQVKTALAAELPEYMVPALLMRLDAMPLSPSGKLDRRALPEPVWQTREHVEPETPLQQQI
AAIWREVLGLPKIGLHDDFFALGGHSLLATQIISRTRQACDVELPLRTLFEASELGAFAE
QVGLIQASGQRNQQTTIAKVDRSEPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARLRGVL
DVGRFEAALQALIMRHETLRTTFPSVDGVAYQKVAPQSGVRMGWQDISALCETERQQRLQ
QLADHEAHSPFNLETGPLLRACLVKAGEQEHYLVLTLHHIVTEGWAMDIFARELSALYEA
FIDERDSPLAPLPVQYLDYSVWQRQWLEAGERQRQLDYWTAQLGHEHPLLELPGDRPRPP
VQSHRGELYRFELSDDLAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIGAPVA
NRIRPESEGLIGAFLNTQVLRCQLNGQMTVGELFEQVRHTVIEGQSHQDLPFDHLVEALQ
PPRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVEYLANDARATKFDLNLEVTDLDHRLGC
CLTYSTDLFDEPRIARMAEHWRNLLQALIASPEQRLSELPLLSATEQRALQDSLGVEAGE
HRLDQCIHTLFSQQAKARGDAPALTFAGVTLSYRELDARANRLAWMLRERGVGPQVRVGL
ALPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFEALGELP
ATVACWCLEDDLPVLENYPADELPFISLAQHQAYLIYTSGSTGKPKGVVVSHGEIAMHCR
AVIERFGMRPDDCELHFYSINFDAATERLLVPLLCGARVVLRAQGQWDAEEICALIRTHR
INILGFTPSYGSQLAQWLATQQQTLPVRMCITGGEALTGEHLQRIRAAFQPQVFFNAYGP
TETVVMPLASLAPEQLEEGAGSVPIGSIIGDRVAYILDADLALVPQGATGELYVGGAGLA
QGYHQRPGMTAERFVADPFARDGGRLYRTGDLVRQRADGLVEYLGRIDHQVKIRGFRIEL
GEIETRLLEYHAVREAVVLALDSPSGKQLVAYLVSDAEHGALRDALKAHLKAQLPDYMVP
AHLIVLDSMPLTANGKLDRRALPQPDPEANRQQYVAPRNPLESTLAAIWCAVLNVPQVGL
DDNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATLVEQVTAEQGVLT
GSSGLTPIQQWFFDTPIPERQHWNQALVLKPLQLLEPHRLEQALLAVLEHHDALRLSFSQ
RDAQWHAEHLAVPQGGVLMQAHVHDMAQCTALFTETQRSLDLAHGPLLRALLVDGPQGQQ
RLLIAIHHLVVDGVSWRVLLEDLQNVYRQLSEGQSVSLPAKTSALRDWAARLQAYAHSES
LREELTVWQAQLAGPAVALPVTRPLGALRNRDADTVSVRLDAEHTRQLLQQAPSAYRTQV
NDLLLTVLARVVCRWSGHDSALIQLEGHGRETLFDDIDLTRSVGWFTSAYPLRLTPLAEQ
GASIKAIKEQLRGIPHKGLGYGVLRYLADDLCKQTLAGLPSAGITFNYLGQFDQSFGADA
LFHPLDESAGLAHDPDAPLPNELSIDSQVYGGELVLRWTFSRERFDRQTLQALADAYLAE
LRSLIAHCLRDDVGGFTPSDFPLAHLSQAQLDSLPVPASVIEDVYPLTPMQEGLLLHTLL
EPGTGLYYMQDRYRIDSALDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHQPGST
PIEYLDWSADPESEQEPRLQALLKKEREAGFDLLNQAPFHLRLIRVGAERYWFMMSNHHI
LIDAWCRSLLMNDFFEIYMALGEGREAQLATPPRYRDYIAWLQRQNLSEARQWWQQNLQG
FERTTPIPSDRPFLREHAGHSGGMVVGDCYTRLEARDGAQLRELAQAHQLTVNTFAQAAW
ALVLRRLSGDRDVLFGVTVAGRPVDMPEMQRTVGLFINSIALRVKLPEDDQRCSVRQWLS
GLLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSD
SGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDETTVQGMLGEFKRLLLALMHGFHGDMAD
LPLMGEQERAFLLHGCNQSAHAYPLERSYVELFEAQVAAHPQRIAASCLDRQWTYDELNR
RSNGLGHALIAAGVGLDQPVALLAERSLDLLGMIIGSFKAGAGYLPLDPGLPSQRLRSII
DLSRTPLLVCTEACREQAIALLDGFDCQLLVWEEVPSRGANPGVYSAPDNLAYVIYTSGS
TGLPKGVMVEQRGMLNNQLSKVPYLQLSETDVIAQTASQSFDISVWQFLAAPLFGARVDI
VPNTIAHDPQGLLAHVQTQGITVLESVPSLIQGMLAEERISLDGLRWMLPTGEAMPPELA
HQWLLRYPQIGLVNAYGPAECSDDVAFFRVDLASTRGTYLPIGTPTDNNRLYLLDGALEL
VPQGAVGELCVAGTGVGRGYVGDPLRTAPVFVPNPFGAAGERLYRTGDLARRRSDGVLEY
VGRIDHQVKIRGYRIELGEIEARLHEQSDVRDAAVGVQEGDNGKHLVGYLVAADETLNPG
ERLDRIKQRLRAELPEYMVPLHWLWLDRLPLNANGKLDRKALPTLEIGQLHSQDYLAPRN
ALEATLTAIWAEVLKVERVGVQDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMFECST
VATLAEYIDGLAANEISAQKVDRLSDLMAELEGL
NT seq 12885 nt NT seq  +upstreamnt  +downstreamnt
atggacgccttcgaacttccccgcaccctggtccagtcccttcaacagcgtgccgagcag
accccggaccaagtggccctgcgctttctcgccgagtccgccgaacagagcatcgtgctc
agttaccgcgacctggacctgcgcgcccgcaccatcgccgccgccctccaggccaacgca
gcgttgggcgagcgtgcggtgctgctgttccccagcggcccggactatgtcgcggcgttc
ttcggatgcctgtacgccggcatcattgcagtgccggcctacccgccggagtccacccgc
cggcatcaccaggcgcgcctgctgtcgatcatcgccgacgccgagccacgcctgctgctg
accatcgccagcctcggcgatggcttggcgcagctcgaaaacgcgccgccggtgttgagt
gtcgacaccctggacgcacaaatcgcggacagctggcgcgcccccgacctgcaacccgac
gacattgccttcctgcaatacacctctggctccaccgcgttgccgaagggcgtacaagtc
agccacggcaatctggttgccaatgaagtgctgatccgccgaggcttcggcatcgacgtg
aacccggacgatgtgatcgtcagctggctgccgctgtaccacgacatgggcctgatcggc
ggcctgctgcaaccggttttcagcggcgtgccctgcgtactgatgtcgccggcgtacttc
ctcggccggccgctgcgttggctggaagcgatcagcgaatacggcggtaccatcagcggc
ggcccggatttcgcctaccgtttatgcagtgagcgggtcagtgagtcggcgttggcgcgt
ctcgacctgagccagtggcgcgtggcctattccggctccgagccgatccgcctcgacacc
ctggaacgcttcgccgagaaattcgcccgttgcggtttcaccgcgaacagcttcttcgcc
tcctacggcctggccgaagcgaccctgtttgtcgccggtggccgccgtggccagggcatc
cccgcgctgcgtgtcgacgaacaggcgttggccgctaaccgcgccgaaccagggcagggc
agtgcgatcatgagttgcggcacgagccagccggaccatggggtgctgatcgtcgacccg
cacaccttgagcgaactggctgacaacggcgtcggcgaaatctgggccagcgggccgagc
atcgcccatggctactggcgcaaccccgaagccagcgccaagaccttcgtacagcacgcc
ggccgcacctggctgcgcaccggtgacctgggctttatccgcgagggcgagctgtacatc
accggccgcctgaaagacctgctgatcgtgcgcgggcacaacctgtatccccaggacatc
gagcagaccatcgagcgcgaagtggaagtggtgcgcaagggtcgcgttgcggcgttcgcg
gtgaatgatcagggccaggaaggtattggcattgcggcggaaatcagccgcagcgtgcag
aagatcttgccgcctgaagcgctgatcaaagccatccgccaggccgtggccgaggcctac
caagaggcgccgtgcgtggtgctgctgctcaaccccggtgccttgcccaagacctccagc
ggcaagctgcaacgcgcggcctgcgcggtgcgtcatgccgatggcagcctcgatagctat
gcgcagttccccgacctgcatgcgccggcgcctaatgcggcgcaggggtcggagctgcaa
agccggatcgcggcgatctggtgcgaacagttgcacgtggcgagcgtggcggccgacgat
cacttcttcctgctcggcggcaactccatcaccgccacccaggtggtcgcgcgcctgcgc
gaagacctcggcctggagctgaacctgcgcatgctgttcgaagccccgaccctggaaggc
tttgccgcgcatatcgcgcaattgcaacaggacggtggcgttgcccaaggcgcgatccac
accctatcgcgcgacgaagacctgccccaatccctggcccagaatcgcttgtggatcacc
tggcaactggatcccctgagcagcgcctacaccatccccggcgccctgcgtttgcgtggc
gagctggatgaagacgcggtacgtgccagcttccagcacttgatccagcgccacgaagcc
ctgcgcacacgtttctatgagcgcgatggccaagccttccagcgtgtggacgccaacagc
gatttcgatctgcacgtcatcgacctcagccacctgcccgccgccgaacgtgacgcccgc
gcgcaacagatccgcgaggacgaagcgcgtacccagttcgacctggaaaacggcccgctg
ctgcgggtgaccctggtacgcctggaggatgaagatcatcaactgctggtgacgctgcac
cacatcattgctgacggctggtcgctgaatctgctcatcgacgagttctcgcgactgtat
gccgccgctgcccagggccaaaccctggcgttgccacccctggctttgcagtacgccgac
tacgcaagctggcaacgccaatggctggccgaaggcgaaggccagcgccaactggcgtac
tggaaagcgcaactgggggaggagcatccggccttgagcctggccaccgaccacccgcgc
tcggcgcagcagcgccacactgcttcacgccacagcgtgcgcctgggcgccagcctcagc
gaagcgattcgccagactgcccagtcccatgagtccacgccattcatgctgttgctggcg
gcgttccagaccttgctctatcgctacagtggccagcgcgatatccgcattggcgtgccc
aacgccaaccgcccacgccaggaaacccagggcctggtcggtttctttatcaacacgctg
gtgctgcgcgccgaactggacgggcgtttgccgttcaaccagctattggccgcgacacgc
caggccgccttgggcgcccaggcgcatcaggacttgcccttcgaacaactgctggaggcg
ttcccgcaggcccgcgaacagggtttgttccaagtgatgttcaaccaccagcaacgcgac
ctgagtgccttgcgccgcctgccgggcatgcttgccgacgagctgccgtggcacagccgc
gaagccaagttcgacctgcaactgcacactgaagaagaccgcaatgggcgcctgggcctg
tcgttcgactacgccgatgaactgttcgagcctgcgacgatccagcgcctggccgaacac
ttcatccacctgctgcacgcgatctgcgagcatccgcaacgtgccctcggcgacctcaag
ctgatgcagcaggacgaacagcaagcgtggagccaggcgccgtgtgcccccgctcaacaa
tggctgcccgaactgctcaacccatctgtctctgatagcaccgcgctggtctggcaggac
ggcagcctgacgttcgcccaactgcatacccaggccaaccgcctggcccattacctgcgc
gacaaaggcgttggcccggacgtgtgcgtggccatcgctgccgagcggtcgccgcagttg
ctgatcggcctgctggcgatcatcaaggccggcggtgcctatgtgccgctggacccggac
taccccgccgagcgcctggcctacatgctccgggacagccgcgcgcacctgctgctgacc
cagaccgccttgctcgaacacctgccgacggccgacggcgtgtgcgtgatcgccatggac
agcctgcacctcgacagttggccgacccagccccctggcctgcacctggagggtgacaac
ctcgcctacgtgatctacacctccggctccaccggccagcccaagggcgtgggcaacacc
catgcggccctggccgaacgcttgcaatggatgcaagccacctatcagctcaaccacacg
gatgtgctgatgcaaaaggcgccgatcagtttcgacgtgtcggtgtgggaatgcttctgg
ccgctgatcaccggctgccgcctggtgctggctggccctggcgagcatcgtgatccgcac
cgtatcgcgcagttggtccaagaacacggcgtgaccacgctgcacttcgtgccgccgctg
ttgcagctgtttatcgatgaacccttggtggccgaatgcaccagcctgcgccgcctgttc
tccggtggtgaagccttgcccgccgagctgcgcaaccgcgtattggcgcagttgccggcg
gtgcaattgcacaatcgttatggcccgaccgagaccgcgatcaacgtgacgcactggcac
tgccgcgtggaggatggcgagcgctcgccgattggccgcccgctgggcaatgtgatctgt
cgcgtgctggatgagcagctcaaccccgtgcccgttggcgtgccgggtgagctgtgcatc
ggtggcattggcctggcgcggggttacctcggtcgtcctgggttgaccgctgagcgcttt
gtcgccgaccaccaaggtgcgcgcctgtaccgcaccggtgaccgcgcccggtggagcgcc
gacggtgtgcttgagtacctcggccgtctcgaccaacaggtcaagctccgcggtttccgt
gtggagccggaagaaatcgaagcgcgcctgctcgccctggacggcatcgcccaggccgtc
gtgctggtgcgtgacgcacagttgatcggctactacaccgcccatgccgagctggacgaa
cagcaggtcaaaactgccctggccgccgagctgccggagtacatggtgcccgccctgctg
atgcgtctggacgccatgcctctgagcccgagcggcaagctcgaccgccgcgctttgccg
gagccggtgtggcaaacccgtgagcacgtcgagcctgaaacgccgctgcaacagcagatc
gccgcgatctggcgcgaggtccttggcctgccgaagatcggcctgcacgatgacttcttc
gccctgggcggccactcgctgctggccacgcaaatcatctcccgtacccgccaggcctgt
gacgtcgagctgccgttgcgcacgttgttcgaagccagcgagttgggcgcttttgctgaa
caggtcgggctgatccaggcgtcggggcaacgcaaccaacaaaccaccatcgccaaggtc
gaccgcagcgaaccggtgccgttgtcctactcccagcagcgtatgtggttcctctggcag
atggagccggacagcccggcctacaacgtcggcggcatggcgcgcctgcgcggggtgctg
gatgtggggcgtttcgaggcggcgttgcaagccttgatcatgcgccatgaaaccttgcgc
accaccttcccgagtgtcgatggcgtggcctatcagaaggtcgcgccgcagtccggcgtg
cgcatgggctggcaggatatctcggcgctctgcgaaaccgagcgccagcaacgcttgcag
cagctggccgaccatgaagcccactcaccgttcaacctggaaaccggcccgctgctgcgc
gcgtgtctggtcaaggccggtgagcaggagcactacctggtgctgaccctgcaccatatc
gtcaccgaaggctgggccatggacatctttgcccgtgaactcagcgcgttgtacgaagcc
tttatcgacgagcgcgactcgccgctggcgccgttgcccgtgcaatacctcgactacagc
gtgtggcaacgccaatggctggaagccggcgaacgccaacgccagctggattactggacc
gcgcaactgggtcatgagcacccgctgctggaactgcccggcgaccgcccacggccaccg
gtacaaagccatcgtggcgagctgtaccgcttcgaattgagcgatgacctggcggcccgc
gtgcgcgccttcaacgccgaacgcggcctgaccctgttcatgaccatgaccgccaccctg
gccgtgttgctctaccgctacagcggccagaccgacttgcgcatcggcgcccccgtggcc
aaccggattcgcccggaaagcgaagggctgattggtgcgttcctcaatacccaggtgctg
cgttgccagctcaatgggcagatgactgtgggtgagttgttcgaacaggtgcgtcacacc
gtgatcgagggccagtcccatcaggacctgccgttcgaccatctggtcgaagccttgcaa
ccgccgcgcagtgcggcgtacaacccgttgttccaggtgatgtgcaacgtgcagcgttgg
gagttccagcagagccgccaactggccggcatgacggtcgagtacctggccaacgatgcg
cgcgcgaccaagttcgacctcaacctggaagtcaccgaccttgaccatcgcctggggtgc
tgcctgacctacagcaccgacttgttcgatgagccgcgcattgcgcggatggccgagcat
tggcgcaatctgttgcaagcgctgatcgccagccccgagcagcgtctgagcgaattgccg
ttgctcagcgccacggaacagcgcgcgttgcaggacagcctgggcgtcgaagcgggcgag
caccgccttgatcagtgcattcacacgctgttcagccaacaggcaaaagcccgtggcgat
gcgcccgcgctgaccttcgccggcgttaccctcagctaccgcgagctggacgcccgcgcc
aaccgcctggcctggatgctgcgcgagcgtggtgtcggcccgcaggtacgcgtcggcctg
gcgttgccgcgctccctggaaatggtcatcggcctgttggcgatcctcaaggcgggcggt
gcctatgtgccgctcgacccggaatacccgctggaccgcctgcactacatgatcgaagac
agcggcattggcctgctgctcagcgatgcggccatgttcgaagccctgggtgaactgccg
gcgaccgtggcctgctggtgcctggaagatgaccttccggtgctggagaattacccggcc
gatgaactgccctttatcagcctggcgcagcaccaggcctacctgatctacacctccggt
tccaccggcaagcccaagggcgtggtggtgtcgcacggcgaaatcgccatgcactgccgg
gccgtgatcgagcgcttcggcatgcgcccggacgactgcgaactgcacttctattcgatc
aacttcgacgccgctacagaacgtttgctggtgccgttgctctgcggtgcgcgggtggta
ttacgcgcccagggccagtgggatgcagaagagatctgcgcgctgatccgtacccatcgc
atcaatatcctcggctttacgccgagttatggcagccagttggcgcagtggctggccacc
cagcagcagacgttgccggtgcgcatgtgcatcaccggtggcgaggcgttgaccggcgaa
cacttgcagcgcatccgcgcagcgttccagccgcaggtgttcttcaacgcctatgggccg
accgaaaccgtggtgatgccgctggccagcctcgcgcccgagcagttggaggagggcgcc
ggcagcgtaccgatcggcagcatcatcggggaccgcgtggcgtacattctcgacgccgac
ctggccttggtgccgcaaggtgcgacgggtgaactgtatgtcggcggcgccggcctggcc
caggggtatcaccagcgtccgggcatgaccgccgaacgcttcgtggccgatcccttcgcg
cgtgacggcgggcgtctttatcgcaccggcgacctggtgcgccaacgcgccgatggtctg
gtggagtacctggggcggatcgaccatcaagtgaagattcgtggcttccgtatcgagttg
ggcgagatcgaaacccgcctgctggagtaccacgccgtacgcgaggccgtggtgctggcg
ctggattcgcccagcggcaaacagctggtggcctacctggtcagcgatgccgagcacggc
gcattacgcgatgcgctcaaggcgcatctcaaggcgcaactgccggactacatggtgccc
gcgcacctgatcgtgctggacagcatgccgttgaccgccaacggcaagctcgaccggcgt
gccttgccgcaaccggacccggaagccaaccgccaacagtacgtggccccgcgcaacccg
ttggaaagcaccctggccgcgatctggtgcgccgtgttgaacgtgccgcaagtcggcctg
gacgataacttctttgaactgggcggcgactcgatcctgtcgatccaggtggtcagccgt
gcgcggcaggcggggattcacttcagcccccgcgacctgttccagcaccagaccgtgcaa
accctggcggcggttgccacgctcgtcgagcaagtgacggccgagcagggcgtgctcacc
ggcagctcgggcctgacgcccatccagcagtggttcttcgataccccgattcccgaacgt
cagcattggaaccaggcgcttgtcctcaagcccctgcaactgctcgagccccatcgcctg
gagcaagcgctgttggcggtgctggaacaccacgacgcgctgcgcctgagcttcagccag
cgcgacgcgcaatggcacgccgagcacttggccgtgccccagggcggcgtgctgatgcag
gcgcacgtgcacgatatggcgcagtgcaccgcgctgttcaccgagacccagcgcagcctc
gacctggcgcacggcccgctgttgcgcgccttgctggtggatggcccgcaagggcaacag
cgcctgctgatcgctatccatcacctggtggtcgatggcgtgtcgtggcgggtgctgctg
gaggatctgcaaaacgtctatcgccaactgagcgaaggccagtccgtcagcctgccggcc
aagaccagcgccctgcgtgactgggctgcgcgcttgcaggcttatgcccacagtgaatcc
ctgcgcgaggaattgacggtatggcaggctcaattggccggcccggccgtggcattgccg
gtgacgcgtcctctaggcgcgctgcgtaatcgggatgcggataccgtcagcgtgcgcctg
gatgccgaacacacccgccagttgctgcaacaggcccccagcgcctaccgcacccaggtc
aatgacctgctgttgaccgtgctggcccgtgtggtgtgccgctggagtgggcatgattcg
gcgctgatccagctggaaggccatggtcgtgaaaccctgttcgatgatatcgacctgacc
cgtagcgtcggctggttcaccagtgcttatccgctgcgcctgaccccactggcggagcag
ggcgcttcgatcaaggcgatcaaggagcaactgcgcggcatcccccacaagggcctcggc
tatggcgtgctgcgttacctggcggacgacctgtgcaagcagaccctggccgggctgccc
agcgccggcatcaccttcaactacctcggtcaattcgaccagagctttggcgccgatgcg
ctgttccacccgctggacgagtctgccggcctggcccatgacccggatgcaccgttgccc
aacgaactgagcatcgacagccaggtgtacggcggtgagctggtgctgcgctggaccttc
agccgcgaacgcttcgatcggcagactctccaggctctggccgatgcctacctggccgaa
ctgcgcagcctgattgcgcactgcctcagggacgatgttggcggtttcacgccgtcggac
ttccccctggcgcacttgagtcaggcgcaactggacagcttgccggtacccgccagcgtc
atcgaagacgtctacccgctgacgccaatgcaggagggtttgctgctgcacaccctgctg
gaaccgggcacgggtctctactatatgcaggaccgctaccgcatcgacagcgccctggac
cctgagcgtttcgcccaggcctggcaggcggtgatcgcccggcatgaagccttgcgtgcc
tcgttctgttggaacgttggcgaagacatgctgcaagtgatccatcagccgggcagtacg
ccgattgagtacctggattggagtgctgatccagaaagcgagcaggagccgcgtctgcaa
gcgctgctcaagaaggagcgcgaagccggtttcgatctgctcaaccaggcgccgttccac
ctgcgcctgatccgcgtcggcgccgagcgctactggttcatgatgagcaaccaccacatc
ctcatcgatgcgtggtgccgctcgttgttgatgaatgacttcttcgagatctacatggcc
ctgggcgaagggcgcgaggcacaactggccacgccgccgcgttatcgcgactacattgcc
tggctgcaacgccagaacctgagcgaagcacgccagtggtggcagcagaacctgcaaggc
ttcgagcgcaccacgccgatcccgagcgaccggccattcctgcgtgaacatgccggccat
agcggtggcatggtggtgggcgactgctacacccgtctcgaggcccgcgacggtgcgcaa
ctgcgcgagttggcgcaggcccatcaactcaccgtcaacaccttcgcccaggctgcatgg
gcgttggtgctgcgccgcttgagcggcgatcgtgacgtgctgttcggcgtcaccgtggct
gggcgcccggtggacatgcccgagatgcagcgcaccgtcggcctgttcatcaacagcatc
gccctgcgggtaaaactgcccgaggacgaccagcgttgcagcgtgcgccagtggttgagc
ggcttgctcgacagcaatatgcaactgcgcgagtacgaatacctgccgctggtgacgatc
caggaacacagcgagttgcccaagggccagccgctgttcgacagcctgttcgtgtttgaa
aatgccccggtggaagtctcggtactggatcgcgcacaaagcctgaatgccacctcggac
tccggccgcacccacaccaacttcccgctgacggccgtgtgctatccgggtgatgacctg
gggttgcacctgtcttacgaccagcgttacttcgacgaaaccaccgtgcaaggcatgctc
ggcgagttcaagcgtttgctgctggcattgatgcacgggttccatggcgacatggccgac
ctgccgctgatgggcgagcaggaacgtgcgttcctgttgcacggctgcaaccagagcgcg
cacgcctacccgctggagcgcagttatgtcgaactgttcgaagcgcaggtcgccgcccat
ccacagcgcattgccgccagttgcctggaccgacagtggacctatgacgaattgaaccgt
cgcagtaacgggctcggtcacgcgctgatcgcggcgggtgtcggcctggaccaaccggtg
gcgttgctggccgagcgtagccttgacttgctgggcatgatcatcggcagcttcaaggcc
ggtgccggttacctgccgctggaccccggcctgccgagccagcgtttgcgcagcatcatc
gacctgagccgtacgccgttgctggtgtgcaccgaggcgtgccgcgagcaggccattgcg
ttgctggacggttttgactgtcagttgctggtatgggaggaagtgccgtcccggggtgcc
aaccctggtgtctacagcgcaccggacaacctcgcctacgtgatctacacctcgggctcc
accggtttgcccaaaggggtgatggtcgagcagcgcggcatgctcaataaccagttgagc
aaagtgccttacctgcaactgagcgagacggatgtgatcgcccagacggcctcgcaaagc
ttcgatatttccgtgtggcaattccttgccgcgccgctgttcggggcgcgggtggatatt
gtgccgaacaccatcgcccacgatccccaaggcttgctggcgcatgttcagactcaaggc
atcacggtgctggaaagcgtgccgtcgctgatccagggcatgctggccgaggagcgcatc
agcctcgatggcctgcgctggatgctgcccaccggcgaggccatgccgccggagctggcg
caccagtggttgctgcgttacccgcagatcggcctggtgaacgcctatggcccggcagaa
tgctcggacgacgtggcgttcttccgcgtcgacctggcctcgacccgtggcacttacctg
ccgattgggacgccgaccgacaacaaccgcttgtacctgctggacggtgcgttggaactg
gtgccccaaggcgcggtaggcgagttgtgcgtagccggtaccggcgtggggcgtggctat
gtcggcgacccgttgcgcaccgccccagtgtttgtgccgaacccgttcggcgcggcgggc
gagcgtttgtaccgcaccggcgacctggcacgccgtcgcagcgatggtgtgctggagtac
gtcgggcgtatcgaccaccaagtgaagattcgcggttaccgcatcgagctgggggaaatc
gaagcacgcctgcacgaacaatcggacgtgcgcgacgcggccgtcggcgtgcaggagggg
gacaacggcaaacacctcgtcggctacctggtggccgccgatgaaaccctgaacccaggc
gaacgcctggaccgcatcaagcaacgcctgcgcgccgaactgccggagtacatggtgccg
ctgcattggctatggctggaccgcctgccgctcaacgccaacggcaagctcgaccgcaag
gccctgcccaccctggagatcggccaattgcacagccaggactacctggcgccgcgcaac
gcacttgaagccaccttgaccgcgatctgggccgaggtgctgaaagtcgaaagggtaggg
gtacaggacaacttctttgaactgggcgggcattcgttgctggccacgcagattgcctcg
cgggtgcagaaaaccctgcaacgggatgtgccgctgcgggcgatgttcgagtgcagcacg
gtggcgacgttggccgagtacatcgatgggctggcggcgaatgagatcagcgcgcagaag
gtggatcgcttgagtgatttgatggcggagctggaaggcttgtaa

DBGET integrated database retrieval system