KEGG   Pirellula staleyi: Psta_0775Help
Entry
Psta_0775         CDS       T01147                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psl  Pirellula staleyi
Pathway
psl00564  Glycerophospholipid metabolism
psl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Psta_0775
Enzymes [BR:psl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Psta_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_2 FAD_binding_3 Thi4 NAD_binding_8 Pyr_redox_3 HpuA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADB15460
UniProt: D2R682
LinkDB All DBs
Position
complement(949069..950703)
Genome map
AA seq 544 aa AA seqDB search
MIDRQANWNRVKLTGNGRKNAENTWDVLIIGGGATGLGAAVDAASRGYKTLLVEQADFGK
GTSSRSTKLIHGGVRYLAQGNVSLVSESLEERGILCRRVPHLVQPLAFLVPSYQWWEKPY
YAAGLKAYQYLAGSLSLGATEIVSRATALEKVSTLRQQDLSGGVVYYDAQFDDTRLLVTL
ATTADYHDAVLLNYARVDDLLIESGKVRGATIVNEETGEEATARARVVISATGAYCDRVR
RMADPSASVIVAPSRGIHLVLPRKFLPGNTALMVPRTRDGRILFVIPWQDRVVVGTTDTP
IDTIPLEPQASEAEIDFVLETAASYLATPPTRADVLSQFAGIRPLVKAGSGSSTSKLARD
HTILTDLSGLVTITGGKWTTYRHMAEDVVTTAAKVGGLATKPCLTRDLPLWGATAEHPAC
DSPGQYVPSASPFAHYGADATAIEKLIEQDPTLGAPLSPSLPLTPAEVVFHARHEMARTV
EDVLSRRSRSLLLDAQASLAIAPQVATLLARELAHDSAWITDQLTQFRELAQHYLPPATS
SSSN
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgtcaggcgaattggaaccgcgtgaaattgaccggaaatggccggaaaaac
gcggaaaacacatgggatgtgctgatcattggcggcggcgctacggggcttggcgctgca
gtcgatgcggcgtcgcgcggctataaaacgctcctcgtcgagcaggccgatttcggcaaa
ggaacctccagccgcagcaccaaactgatccacggcggcgttcgctacctggcgcaaggc
aacgtctcgctggtgagcgagtcgctcgaagagcggggcattttgtgtcgccgcgtcccg
catctggtgcagccgctcgccttcctcgttccgtcgtaccagtggtgggaaaagccgtac
tacgccgctggtctcaaggcgtatcagtacctggccggaagtctctcgctcggcgctact
gagatcgtttcgcgcgcgacggcgcttgaaaaagtaagcaccctccgtcagcaagatttg
agtggcggcgtggtctactacgatgctcagttcgacgacacgcggctgctcgtcaccctc
gccaccaccgccgactaccacgatgcagtgctgctgaactacgcccgggtcgacgatctg
ctgatcgaatcgggaaaggttcgcggcgcgacgatcgtcaacgaagagactggcgaagaa
gcgaccgcccgcgctcgcgtggtgattagcgccaccggcgcgtattgcgatcgagtacgc
cgcatggccgacccgagcgccagcgtgattgtcgccccgagccgcggcattcacctcgtc
ttgccccgcaaattcctgccgggcaatactgccttgatggtcccccgcactcgcgatggc
cgcatcttgttcgtgatcccgtggcaagatcgggtcgttgtcggaaccaccgatacgccg
atcgataccattccgctcgagccccaggccagcgaggccgagatcgattttgtactcgag
accgctgccagctacctcgccaccccgccaacacgcgccgatgtgctgagccaatttgcc
gggattcgtcccttggtgaaagcggggagcggatcgagcacctcgaagctggcccgcgat
cacacgatcctcaccgacctaagcggtctggtgaccatcaccggcggcaagtggaccacc
tatcgccacatggctgaagatgtggtgaccaccgctgccaaagtgggtggcctggcgacc
aagccttgcctgacgcgcgacctgccgctgtggggagccacagccgagcatcccgcttgc
gacagcccgggccagtatgtcccgtcggcctccccctttgcgcactacggcgccgatgcc
acggcgatcgaaaaactgatcgagcaagatcccacgctcggcgctccgctgagccccagc
ttgcccctcaccccggccgaagtggtgttccacgcccgccacgaaatggcccggaccgtc
gaggatgtcctctcccgccgcagccgctcgctcttgctcgacgcccaggcttccctggcg
atcgccccgcaagtcgccaccctcttggcccgcgaactcgcccacgactctgcctggatc
accgaccaactcacccaattccgcgaactcgcccagcactacctgccaccagcaacctca
tcgtcctcgaactga

DBGET integrated database retrieval system