KEGG   Pirellula staleyi: Psta_1244Help
Entry
Psta_1244         CDS       T01147                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psl  Pirellula staleyi
Pathway
psl00620  Pyruvate metabolism
psl00680  Methane metabolism
psl01100  Metabolic pathways
psl01120  Microbial metabolism in diverse environments
psl01200  Carbon metabolism
Module
psl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psta_1244
  Energy metabolism
   00680 Methane metabolism
    Psta_1244
Enzymes [BR:psl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Psta_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADB15922
UniProt: D2QW47
LinkDB All DBs
Position
1542686..1545514
Genome map
AA seq 942 aa AA seqDB search
MLKTRHDVCRPQAVYIHAKGGFEMAPVSNELLRRDVRMLGDMLGEVMTEAAGPEALALVE
EIRQLARRRRSGDHTAEPELAEKIASLSMSDARIVARAFSIFFDLANLAEDRHRIRVLRS
REQELHPVSLSESIGAAIGRLKESGFSAAETQRAIDKMLIELVFTAHPSEAKRRSIRAKL
RRMRHALQELDRTDLLPRERARLESRIRTELTVLWQTDFLRPSRPTVLEEVERGLSITPR
LWEVVPQVYASMRLALDTHYPGEGIRPGLFLRFGSWMGGDRDGNPNVTAPITKQTLVWLR
ERAISQHLALTKTMYDFLSISVREIDADSTLNKGLEEASQKWPGLAEALSELAPLEVYRR
WVTMIRWRLSQSSATTSCTSIPEGGYRDGEELFADLKAMQDSLRSHHSRLLADSELQRWL
DLTTVFGLHLTRLDVRQDARRYREVMTEILSVAGIVENYADLPEAERCAALSRSIPWDHD
LDREKLSPLALETLDLFLVLRDAIAVFGPSCIGGHVISLTQCPSDVLNVLWLWRWAQSKA
VRDSSVPTTDELRIIPLFEKIDDLRNAPETMTSILEHPLYREHVTRVGDRQIIMVGYSDS
TKDGGYLAACWGLYQAQSGLQQVAHDHGVQVTFFHGRGGSLGRGGGPAARGILSLPPEAL
DGTLRLTEQGEVLAERYDDTQVAFRHLEQVTWATLVASALPGVQVKPSWLSMMETLSVQS
FKAYRELVDQPGFIAFFAAATPIDEIENLPIGSRPSRRRGERTLGDLRAIPWVFSWTQNR
CMIPAWYGLGTALSEVKYKDRTAWQTICEMYRLWPFMQATIDNAMLALAKADMYIAQHYS
ELAEDPAQRQVCWELIARERDRTRQALLDLVGGSELLSKNPWFQGSIEVRNPYIDPLNLI
QIELLRRRRSLTPEAPANEAEQLRDMLRLTVQGIAAGMRTTG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaacccggcatgatgtttgccgcccccaagcggtttacatccatgcgaaaggc
ggctttgaaatggcaccggtgagtaacgagttgttgcggcgcgacgtgcgcatgctgggc
gatatgctgggcgaggtgatgaccgaagcggcgggccccgaagcgctcgccctggtcgag
gagatccgtcaactcgcacgccgccgacgaagtggcgaccacacagcggaacccgaactg
gccgagaagattgccagcttgtcgatgtccgatgctcgcatcgtggcccgcgcgttcagc
atctttttcgacctggcgaacctggcggaagatcgccatcgcattcgtgtccttcgcagc
cgcgaacaagagctccacccggtctcgctcagcgaatcgatcggcgcggcgatcggtcgc
ctgaaggagtcggggttctcagccgccgaaacgcagcgcgcgatcgacaagatgctgatc
gagctcgtctttaccgctcatccgagcgaagccaagcggcgctcgattcgggccaagctg
cggcggatgcggcacgctctgcaggaactcgaccggaccgatctgctgccgcgcgagcgg
gctcgtctcgagtcgcgcatccggaccgagctgaccgtgttgtggcaaaccgatttcttg
cgccccagccgaccgacggtgctcgaagaggtcgagcgtggtctgtcgatcaccccgcgg
ctgtgggaagtggtgccgcaggtttatgcctcgatgcgtctggcgctcgacacgcactat
cccggcgaagggatcaggccgggactcttcctccgcttcggttcgtggatggggggcgat
cgcgacggcaaccccaacgtcaccgcaccgatcaccaagcaaacactcgtgtggctccgc
gagcgcgcgatctcgcagcatctggccctcacgaaaacgatgtacgatttcctgagcatc
agcgtgcgcgaaatcgatgccgattcgaccctcaacaaaggactggaagaggcgtcgcaa
aagtggcccggactcgccgaagccttgagcgagcttgcgccgctggaagtctatcgccgc
tgggtgacgatgattcgctggcgcttgtcgcagtcgagcgccaccaccagctgcacttcg
attcccgaagggggctaccgcgatggcgaggagctgtttgccgacctcaaggcgatgcaa
gacagcttgcgctcgcaccacagccgcttgctggccgatagcgagctgcagcggtggctc
gatctgacgacagtgtttggtttgcatctcacgcgactcgatgtgcggcaagatgcgcgg
cgctatcgcgaagtgatgaccgagatcctctcggtcgctggaattgtcgagaattacgcc
gatttgcccgaagcagaacgctgcgccgccctctcgcgctcgattccgtgggaccacgat
ctcgatcgcgaaaagctgtcccccttggcgctcgaaacgctcgatctgttcctcgtgctc
cgcgatgcgattgccgtgttcggccccagctgcatcggcggccatgtgatcagcctcacg
cagtgcccgagcgacgtgctgaacgtcctgtggctctggcgctgggcgcagtcgaaagcg
gtgcgcgacagcagcgtgccgaccaccgacgagctccgcatcattccgctgtttgaaaaa
atcgacgacctgcgaaatgcccccgagacgatgacctcgatcctcgagcatccgctctat
cgcgagcatgtcacgcgggtcggcgatcgtcagatcatcatggtcggctatagcgacagc
accaaagatggtggctatctcgcagcctgctggggactctatcaggcccaaagtggtctg
cagcaagtggcccacgatcacggcgtacaagtcaccttctttcatggtcgaggtggctcg
ctcggacgtggtggtggacctgccgcgcgtggcattttgtcgcttcctcccgaagcactc
gacggcacgcttcgactcaccgagcaaggagaagtgctggccgaacgctacgacgataca
caggtcgcattccgccatctcgagcaagtcacttgggccacactcgtcgcctcggcactt
ccgggcgtgcaagtgaaaccgtcgtggctctcgatgatggaaacgttgtcggtgcagtcg
ttcaaagcctatcgcgaactggtcgatcagcctggattcatcgccttcttcgccgcagct
acgccgatcgatgagatcgagaacttgccgatcggatcgcgtccgagtcgacgtcggggc
gaacgtacgctcggcgatttgcgggcgattccgtgggtcttttcgtggacgcaaaatcgg
tgcatgatccccgcctggtacggtctcgggaccgcgctcagcgaagtgaagtacaaagat
aggaccgcgtggcaaacgatctgcgagatgtatcgcctctggcccttcatgcaggcgacg
atcgataacgcgatgctcgcgctggcgaaggccgacatgtatatcgcgcagcattattcc
gagctggccgaagatcccgcccagcgccaagtttgctgggagctgatcgcgcgcgagcgt
gatcggacgcgtcaagcgctcctcgatctggtcggtggtagcgaattgctctcgaaaaac
ccctggtttcaaggctcgatcgaagttcgcaatccgtacatcgatccgctgaacttgatt
cagatcgagctgctccgtcggcgtcgttcgctgacccccgaagccccagccaatgaggcg
gaacagctgcgcgacatgctccggctcaccgtgcaagggatcgccgccggcatgcgcacc
accggctaa

DBGET integrated database retrieval system