KEGG   Pirellula staleyi: Psta_1795Help
Entry
Psta_1795         CDS       T01147                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
psl  Pirellula staleyi
Pathway
psl00220  Arginine biosynthesis
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01130  Biosynthesis of antibiotics
psl01210  2-Oxocarboxylic acid metabolism
psl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Psta_1795
Enzymes [BR:psl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Psta_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADB16470
UniProt: D2QZ15
LinkDB All DBs
Position
2247581..2248789
Genome map
AA seq 402 aa AA seqDB search
MSLDVVATLADLVRIPSVNPMGRATSGDIYYEHRVTDYLEQLFRTLELPYERVLVSEQRP
NIIARVDGDLPPEQGGKVLMFEAHQDTVPIEGMTIDPFDPKIESGKLFGRGSCDIKGGMS
AMLGVVARLHREKPRGRPTVVMACTVNEEHGFTGATHWARAYAGFEGNPPTSRMLQRVPD
ATIVAEPTSLDVVVAHKGGVRWRCHTVGRATHSSQPHLGENAIYAMARLLPSFEKYALEV
APTLGSHHLCGKPTLSVGTIKGGISVNTVPDRCTIEIDRRLLPGESPETARQHVIDYLAA
QVPNVRPVHDEPFLTSFGLADDCNGTLASELAAASKLHGGRGGKIGVPYGTDAPRFAQTG
CPTVVFGPGSIDQAHTCDEWIEISQLQAASEILYDFAANFGR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgatgtcgtcgccacgttggccgatttggttcgcatcccgagtgttaatccg
atgggacgcgccacgagcggagatatctactacgagcatcgggttactgactacctcgag
caactttttcgcacgctcgagctcccttacgaacgggtgctggtctccgagcaacggcca
aacatcatagcgcgtgtcgatggcgatctgcctcctgaacaagggggcaaagtgctgatg
ttcgaagcccatcaagacaccgtgccgattgaagggatgacgatcgacccgttcgatccc
aagatcgagagcggaaagcttttcggtcgtggttcgtgcgacatcaaaggtggcatgtcg
gcgatgctgggtgtagtcgcccggttgcatcgcgaaaagccacgcggtcgacccacggtg
gtgatggcatgcaccgtgaatgaagaacatggattcactggcgctacgcactgggcccgc
gcctatgcgggcttcgaaggtaatcctccgacgagccgcatgctacagcgagttcccgac
gctacgattgttgccgagccaacgtcgctcgatgtcgtcgtggctcacaaagggggagtg
cgctggcgctgccataccgtggggcgtgcgacgcacagttctcagccccacttgggcgag
aacgccatctacgccatggcccgtctgcttccgagcttcgagaagtatgccctggaagtc
gctccgactctcggctcgcatcacttgtgcggaaagccgacactcagcgtcggcacgatc
aaagggggaattagtgtaaacactgttcccgatcgatgcaccatcgaaatcgatcggcgt
ctgcttcctggcgagagtcccgagacagctcgtcagcatgtcatcgactatctcgcagcg
caggtgccgaacgttcgcccggtgcacgacgagccgttcttaacaagctttggactcgcc
gacgattgcaacggaacgcttgcgagcgaacttgcagccgccagcaaactccacggcggg
cgaggtggaaaaatcggcgtgccgtatggaaccgacgcacctcgatttgcacaaacgggt
tgcccgaccgttgtgtttggcccgggaagtatcgatcaagcacacacctgcgacgagtgg
atcgaaatctcgcagctgcaggccgccagcgaaatcctgtatgacttcgcagccaatttc
ggccgataa

DBGET integrated database retrieval system