KEGG   Pirellula staleyi: Psta_4673Help
Entry
Psta_4673         CDS       T01147                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
psl  Pirellula staleyi
Pathway
psl00260  Glycine, serine and threonine metabolism
psl00630  Glyoxylate and dicarboxylate metabolism
psl00670  One carbon pool by folate
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01130  Biosynthesis of antibiotics
psl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psta_4673
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psta_4673
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Psta_4673
Enzymes [BR:psl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Psta_4673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ADB19315
UniProt: D2R7Y4
LinkDB All DBs
Position
complement(6082320..6083441)
Genome map
AA seq 373 aa AA seqDB search
MTASLRQTPLHDWHVARGGRMVDFAGWSMPVQYGSIVEEHNTVRNKAGLFDVSHMGRLRV
EGPGALAYLDSLVTRKVAGMGPGKIRYGLVCNEAGGILDDILVYHLQQHGGGLYALVVVN
ASNRDKIVSHFQAHLPASGDVTLDDRTLETAMIAVQGPKALAVVEPLVGVDVGGLSYYTG
TETTICGKPGIVSRTGYTGEDGCEVILPAEAAKDFCDKCLEHGVSVGAAPAGLGARDTLR
LEAAMPLYGHELSESLDPLQAGLDFAVTLEGREFLGRQAILNRRADKERPVRVGLELAGR
RAAREHYAVYSGDKRVGEVTSGAFAPTVQKAIAMAYVEPQLAAVGTELAVDIRGTMETAR
VVSLPFYKRPKTS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgtcgcttcgtcaaacgccgcttcacgattggcacgttgcccgcggtggtcgc
atggtggatttcgccggctggagtatgccggttcaatacggctcgatcgtcgaagagcat
aacaccgtccgcaacaaggccggtctcttcgatgtctcgcacatgggtcgacttcgtgtc
gaaggaccaggcgctctcgcatacctcgattcgcttgtcactcgtaaagtggctggcatg
ggtcctggaaagattcgctacggcctcgtttgcaacgaagcaggcggaattctcgacgat
attctcgtctaccatttgcagcagcatgggggcggactctatgccctcgtcgtggtgaat
gcgagcaaccgcgacaagattgtgagccatttccaggcacatcttccagcctccggcgac
gtgacgctcgacgaccgaactctcgaaaccgcgatgatcgccgtgcaaggtcctaaggct
ttggctgtggtcgaaccgctggtgggtgtggatgtcggcggactctcgtactacaccggc
acagaaaccaccatctgcggcaagccaggcattgtcagccgcacgggttacacgggtgaa
gatggctgcgaagtgatcctgccagctgaggcagcgaaagatttctgcgacaaatgcctc
gagcatggggtgagtgtcggtgccgcgccggccggacttggcgcacgcgatacgctgcgt
cttgaagccgcgatgcccctttatggccacgaactctctgaatcgctcgatccgctgcag
gcggggctcgatttcgcagtgaccctcgaaggtcgcgagtttctggggcgtcaagcgatt
ctgaatcgtcgcgccgacaaagagcgacctgtccgtgtcggtctcgaactggctggccgt
cgcgctgcccgcgagcactatgcggtctactccggcgacaagcgagtaggggaagtcacc
agcggcgcttttgcacccacggttcaaaaagcaatcgccatggcttacgttgagccacaa
ctggccgctgtcggaaccgaactggccgtcgatattcgcggcactatggaaacggctcgc
gttgtttcccttccgttttacaaacggcccaaaacttcgtaa

DBGET integrated database retrieval system