KEGG   Pseudoalteromonas sp. SM9913: PSM_A0793Help
Entry
PSM_A0793         CDS       T01374                                 

Definition
(GenBank) cysteine sulfinic acid decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00250  Alanine, aspartate and glutamate metabolism
psm00410  beta-Alanine metabolism
psm00430  Taurine and hypotaurine metabolism
psm00650  Butanoate metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PSM_A0793
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSM_A0793
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSM_A0793
   00430 Taurine and hypotaurine metabolism
    PSM_A0793
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSM_A0793
Enzymes [BR:psm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PSM_A0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADT67741
LinkDB All DBs
Position
I:852182..853807
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAAIPEEPTFVSCYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYSQSDGFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKADGNFKGIAAQGLVAGMLHYGHKGLAVLISERGHYSLGKSVDLLGIGRENL
IGIKTSADNKVDVSAMREKALELEAQGIKVMAIVGVAGTTETGNIDPLEDMANLAQEINC
HFHVDAAWGGATLLSNTHRHLLKGIEHADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKARYFADLI
KADEDFELISEPELCLLTYRYVPKQIKHAIAQADAQTRLDIFAALNRFTASMQKRQRESG
RSFVSRTRLTPVQYDNQPTVVFRVVLANPLTSGAILKEILEEQKELAQTDPVFKKYLRKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaaacggatattcaccgtt
ccagaggcgccagactcaactttgagcaaaatagagcttgaaatttcgagtaatttagca
ggtttcttaaacgaaaatatcgcggcaattgaaaaaccattacatgaaatagaaaaagat
tttcaatcggcggcaatccctgaagaaccgacgtttgtgtcttgctatgctcaagatatt
atggagcagctggttgctcattctgttcataccgcagcgccaagctttattggccatatg
acatcggctctgcctcattttttactaccgttatcgaaattaatggttgggttaaatcaa
aacctagtaaaaattgaaacctcgaaagcgtttaccccattagaacgtcaagttttaggg
atgatgcatcatttagcttatagccaaagtgatggtttttattctaaatggatgcacagt
gcaaaaacttcgttaggggcattttgctctggcggcaccgtggcaaatattactgcactt
tggatagctcgaaaccgcttattaaaagcggatggcaattttaaaggcattgctgcacaa
ggtttagttgcaggaatgcttcactatggtcacaaagggctggcagttttaatttctgaa
cgaggtcattattcgcttggtaaatcggttgatttattaggtattggtcgtgaaaattta
attggtatcaaaacttctgccgataacaaagtcgatgttagtgcaatgcgagaaaaagcg
ttagagcttgaagcacaaggcattaaagtgatggcaattgttggggtcgcaggaaccact
gaaaccggtaatattgacccacttgaagatatggctaatttagcacaagagattaattgt
cattttcatgttgatgcagcgtggggtggagctactttactgtctaatacccataggcat
ttattaaaaggtattgagcatgcagattcaatcaccattgatgcgcataagcaaatgtat
gtgccgatgggggccggtttagtcttatttaaagaccctgctgcaactgatgccatcgag
catcatgctgaatatattttacgtaaaggctctaaagatttaggcagccatacgcttgag
ggaagtcgccctgggatggcgatgttagtgcatgcttgcttacgtgttattggtcgtaaa
ggctatgaaatgcttatcgatcgcagtattaaaaaagcgcgttattttgctgatttaata
aaagccgatgaagactttgagttaatatcagagccagaactttgcttactgacctatcgc
tatgtaccaaaacaaattaaacacgcgatagcccaagctgatgcacaaacccgtttagac
atttttgccgcgcttaatcgttttactgccagcatgcaaaaacgccaacgtgaatcgggt
cgctcatttgtatcgcgtacgcgtttaacgccagttcaatatgataaccaaccaaccgtg
gtatttagagtggtactggcgaacccgcttacctcaggtgctatattaaaagagatatta
gaagagcagaaagaactggcacaaactgatccggtgtttaaaaagtatttacgaaaatat
atgtaa

DBGET integrated database retrieval system