KEGG   Pseudoalteromonas sp. SM9913: PSM_A2521Help
Entry
PSM_A2521         CDS       T01374                                 

Definition
(GenBank) beta-lactamase
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSM_A2521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psm01002]
    PSM_A2521
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psm01011]
    PSM_A2521
Enzymes [BR:psm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PSM_A2521
Peptidases and inhibitors [BR:psm01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   PSM_A2521
Peptidoglycan biosynthesis and degradation proteins [BR:psm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PSM_A2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ADT69435
LinkDB All DBs
Position
I:complement(2691780..2693438)
Genome map
AA seq 552 aa AA seqDB search
MYWALKMINNKTYYKVVILLLSIIIAGCSRSTAIKSERPLTVNHINALANAQVIATFPEP
NPSSREYVNNRGTFKAYRGHGQLLLQNVSAVSADIYINNKKLSLNEPLRANTEYDFNLGH
YTHNGVNTFKVENIQPAGGSLTLRFAFATLENSATKEIDFSQVDTLIENDIKAGFPGAVL
AVVKAGKVLKLTAYGDAKQYQQSDLMLLRPEPMQTNTLFDLASNTKIFATNFALMKLVSE
GQLNINHTVHSYLKEYQGNGREHRQVKDLLTHSAGYPPVFDFHRKDTAYGDAFFSQTSET
TKQLLLTSVPLTAEPTAPHVYSDIDYMILGVLIERISGQPLDEYLEQHIYAPLKLNNTLF
NPLKKGFNRQQFAATELSGNTRDGRIHFDNIRTNVLQGQVHDERAYYSLDGVAGHAGLFS
NAPDLAVLCQVLLNKGGYGDTQIFNASSLAQFLTPQSSDETYGLGFRLAGNNQARRWHFG
PYASAQAYGHTGWTGTVTVIDPAYDLAIILLTNARHTPIKGTEKRYQFVGKNFETAQYGS
IVSLVYEALLNQ
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtattgggctttaaaaatgataaataataaaacgtactataaagtagttatattgctg
ctgagcattattattgcgggctgtagtcgctctacagcaattaaatcagagcgcccttta
acggttaatcatatcaacgcgttagctaatgcgcaggtgattgctacctttcctgagcca
aatcctagcagcagagaatatgtaaataaccgcggcacttttaaagcctaccggggccat
ggacaactattgctacaaaatgtcagtgcggttagcgccgatatatacatcaataataaa
aagctctcacttaatgagcctttacgcgctaacaccgagtacgactttaatttagggcac
tatacgcataacggcgtgaacacctttaaggtagagaacattcaacctgctggcggcagt
ttaaccctgcgctttgcatttgctaccttagaaaatagcgccacaaaagaaatcgacttt
agccaagttgataccttaattgaaaacgatataaaagcaggctttccaggagcggtatta
gcggttgttaaagcgggtaaggtattaaaattaactgcgtatggcgatgcaaaacaatat
cagcaaagtgatttaatgcttctgcgcccagagcctatgcaaaccaataccttatttgac
ttagcctcaaatactaaaatatttgctactaactttgcattaatgaagttggtcagcgag
gggcagttaaacataaatcatacggtgcattcatacctaaaagagtatcagggtaatggt
cgagagcaccgccaagtaaaagacttactaactcatagtgccggttatccgccagtgttt
gattttcatcgaaaagacaccgcttacggcgatgcgtttttctcacaaacaagcgaaacc
actaaacagctattattaacaagtgtgccattaaccgctgaacctacagcgccgcatgtt
tactctgatattgattacatgattttaggggttttaattgagcgaattagcggccaacct
ctcgatgaatacctagagcagcatatttacgcgcctttaaaactcaataacaccttattt
aatccgcttaaaaaaggttttaatcgtcagcagtttgctgccacggagcttagcggtaat
actcgagatgggcgtattcattttgataatattcgcaccaatgtactgcaagggcaggtg
catgacgaacgtgcttattattcgctcgatggtgttgcaggccatgcgggattatttagt
aacgctcccgatttagctgtgctgtgccaagttctacttaacaaaggtggttatggcgat
acgcaaatttttaacgccagtagcttagcgcaatttttaacgccacaaagcagtgatgaa
acctacgggttaggctttcgtcttgcgggaaataaccaagcacggcgttggcactttggc
ccttatgccagcgctcaggcctatggccacacggggtggacaggcacagtcaccgtgatt
gatccggcttacgatttggccattattttactcactaatgcgcggcatactcctattaaa
ggcactgaaaagcgctatcaatttgtagggaaaaattttgaaacagcgcaatacggctct
attgtgtcgcttgtttatgaggcattattaaatcaataa

DBGET integrated database retrieval system