KEGG   Pseudoalteromonas sp. SM9913: PSM_A2768Help
Entry
PSM_A2768         CDS       T01374                                 

Gene name
suhB
Definition
(GenBank) inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00521  Streptomycin biosynthesis
psm00562  Inositol phosphate metabolism
psm01100  Metabolic pathways
psm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PSM_A2768 (suhB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSM_A2768 (suhB)
Enzymes [BR:psm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     PSM_A2768 (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ADT69681
LinkDB All DBs
Position
I:2951435..2952238
Genome map
AA seq 267 aa AA seqDB search
MHPMLNIAVRAARNAGKLILRASEDLSKVEVQQKGTNDLVTNIDKEAEAVIRDTILRSYP
DHCIVGEELGEHKGKDADYQWIVDPLDGTTNFIKGIPHFAVSIALKVKGRLDQAVIYDPI
RGELFTASRGQGAQLNSKRLRVSKTVELAGSVLATGFPFKQKHHLDAYSEAFKALFVHTA
DIRRAGSAALDMAYVAAGRVDGFFEIGLKPWDTAAGELLVKEAGGMVVDFAGGNNYNVSG
NVICGAPKLTQAIVREMRPVLSESLLR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaatgttaaacattgcggttcgcgctgcgcgtaacgcaggcaagcttattctt
cgtgcaagtgaagacttatcaaaagttgaagtgcaacaaaaaggcactaatgatttagtt
acgaacattgataaagaagccgaagccgtaattcgtgacactattttacgttcttaccct
gatcactgcatcgttggtgaagagttaggtgaacacaaaggtaaggatgctgattaccaa
tggattgttgacccacttgatggcacaactaacttcatcaagggtatccctcatttcgca
gtatcaattgcacttaaagttaaaggtcgtttagaccaagccgtaatttacgatccaatt
cgaggcgaacttttcaccgcttctcgtggtcaaggcgcacagttaaacagcaaacgttta
cgtgtatctaaaacggttgaacttgccggttctgttcttgcaacaggtttccctttcaaa
caaaaacaccacttagatgcctattctgaagcgtttaaagcattattcgtacataccgct
gatattcgtcgtgcaggttctgcagcacttgatatggcatatgttgcagcgggtcgtgtt
gatggtttctttgaaattggtttaaaaccgtgggatacagcagcaggcgagctattagtt
aaagaagctggcggcatggttgttgattttgctggcggtaataactacaacgtgagcggt
aacgttatttgtggtgcacctaagctaacacaagcgattgttcgtgaaatgcgcccagta
ttatctgagtcgttattacgttaa

DBGET integrated database retrieval system