KEGG   Pseudopedobacter saltans: Pedsa_0038Help
Entry
Pedsa_0038        CDS       T01430                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00240  Pyrimidine metabolism
psn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pedsa_0038
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Pedsa_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ADY50627
UniProt: F0SC42
LinkDB All DBs
Position
complement(43158..43724)
Genome map
AA seq 188 aa AA seqDB search
MKRNKEFGGSIEVICGSMFSGKTEELIRRLTRAKIAKLNVEIFKPKTDTRYDESAVVSHN
ANAIPSIPVENSSAILLYGSDVEVIGIDEAQFFDDELPDVCVKLANKGIRVIVAGLDMDF
TGKPFGPIPALMAIAEDVTKVQAVCMKCGAPALYSLRLNSNPNKVLLGEKESYEPRCRVC
YNEDKASY
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggaataaagagtttggcggtagtatagaggtcatttgtggttctatgttctct
ggaaaaacagaagagttaatcaggagattaacgagagcaaaaattgcgaagctaaatgta
gagatttttaagccgaagacagacacccgttatgatgaaagcgcggtagtatctcataat
gccaatgcaatcccttcaataccggtagaaaattcctcagctattttattgtatggaagt
gatgtagaagttatcggaatagacgaagctcaattctttgatgacgaactccctgatgtt
tgtgtaaaattagccaataaggggatccgcgttattgtcgctggattggatatggatttc
acgggaaaaccttttggaccaatacctgcattaatggctatcgcagaagatgtaactaag
gtgcaggcagtttgtatgaaatgtggtgctcccgcattatatagtttaaggttaaacagc
aacccaaataaggttttgctgggcgaaaaagaaagttacgaacctcgctgcagggtttgt
tacaacgaagacaaagcatcgtattaa

DBGET integrated database retrieval system