KEGG   Pseudopedobacter saltans: Pedsa_0984Help
Entry
Pedsa_0984        CDS       T01430                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00473  D-Alanine metabolism
psn01100  Metabolic pathways
psn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pedsa_0984
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Pedsa_0984
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psn01011]
    Pedsa_0984
Enzymes [BR:psn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Pedsa_0984
Peptidoglycan biosynthesis and degradation proteins [BR:psn01011]
 Precursor biosynthesis
  Racemase
   Pedsa_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase RWP-RK DUF3320
Motif
Other DBs
NCBI-ProteinID: ADY51555
UniProt: F0SAW0
LinkDB All DBs
Position
1170834..1173290
Genome map
AA seq 818 aa AA seqDB search
MKEFTYSIEQISALISEKSSLPFPNQVIHRLLTDSRKVTETKNTLFFVLKGRKNAHHYIK
DLYHKGVRSFVYYDQGFDITNFPDANFLYSPDPLRALQNLAAVHRGKFSFPVIGITGSNG
KTVVKEWLYQLLAYKYTIVRSPKSYNSQIGVPLSIWKMDTLYNLAIFEAGISQTGEMERL
EKIIKPSIGVFTNIGSSHDEGFSDKEEKIAEKFKLFAHVNKLICNKEFSEYAPQSVDLYT
WSLDDNTANLYVKEISVEDTGTSIKSTYEDREISIKIPFKDKASTENAITCLLVMLVFGY
SESEIEDKMSKLHPVKMRLEMKSGINNTSIIDDSYNSDLSSLEIALDFLNHQQQHQNKTL
ILSDIQQSGLDGQQLYQTVARLLESKGVDKVIGIGEEISKHQNLFGSNSSFFSDTSNFLD
KLDLSAFRDETILLKGARTFGFEKISSALSQQVHETILEINLNAMEHNLNYYRSKLKPGV
KLMTMVKAFGYGSGSFEIANLLQFNHVDYLSVAYADEGVTLRQNGITLPIMVMSPEISSL
EAIVKHQLEPEIFSQSTLEAFSNYLQNAGISNYPIHLKLDTGMHRLGFMPDELDFIADFI
KTKNTVKIQSVFSHLVASESPIHDDFTRQQISIIKDFTNKLEQRIGYTFIKHICNTSAIT
RWPEAQFDMVRLGIGLYGVDNFSEDDENLEQVAVLKTTVSQIKQIKRGETIGYGRRGVMP
EDGQIATVKIGYADGFLRALGNGVGSMFINGEEVFTIGNICMDMCMLNITGKNVKEGDEV
IVFNSQKRLYKLAEKLNTIPYEILTSVSQRVKRVYYYE
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtttacctatagcatcgagcaaatatctgccttgataagtgaaaaatcatct
ttaccctttccaaatcaagtaatccatcgtctattaacagatagtagaaaagtaacagaa
acaaaaaatacactgttttttgtgttgaaaggaagaaagaatgctcaccattatataaag
gatctttatcataaaggtgtacgctcctttgtttattacgatcaaggttttgatataacg
aactttcccgatgctaatttcctttactctccggatccattaagagctttgcaaaatttg
gctgccgttcatcggggaaaatttagctttccggttattggaatcacaggcagtaacgga
aaaacggttgttaaagaatggctttatcagctattggcttataaatatacgattgttaga
agtcctaaaagttataattctcaaataggtgttccgctttcgatatggaagatggatact
ttgtataatctggcaatttttgaagcaggtatctctcaaacgggagaaatggaaaggtta
gagaagattataaaaccaagtataggtgtttttacgaatataggttcgtctcatgatgaa
ggattttctgataaagaagaaaaaatagcagaaaaatttaagctgtttgcgcatgtaaat
aaattgatttgcaacaaagaattctcagaatacgctcctcaatcggtagatttatacacc
tggagtttggacgataatactgctaacctttatgtgaaagagattagtgttgaagatact
ggaacatccataaaatctacttatgaagacagagaaataagtataaaaataccctttaaa
gataaagcttcaacagagaatgcgataacctgtcttttggttatgttggtgtttggatat
agcgaatcggagattgaagataaaatgtccaagctgcatcccgtaaagatgcgtttggaa
atgaagagtggaattaacaatacttcaattattgacgattcatataattccgatttgtct
tcgttggaaatagcattagattttctaaatcatcagcaacagcatcaaaacaaaactttg
attttgtctgatattcaacaatcaggtttagatgggcagcaactttatcaaactgtagcc
agattattggaaagcaaaggagttgataaagtgattggtattggagaagaaatatcaaaa
caccaaaatctgttcgggtcaaatagctcgtttttttcagataccagtaactttttagat
aagctcgacttgtctgcatttagagacgaaacaattttgctaaaaggagcaagaacattt
ggtttcgaaaaaataagcagtgcgctcagtcaacaggttcatgaaaccattctggagatt
aatttaaacgccatggagcataatttaaattattatcgctctaagttaaagccaggagtg
aaactaatgactatggtgaaggcattcggttatggcagcggtagtttcgaaatagcgaat
ctgttacaatttaatcatgtcgattacttgtcagttgcatacgccgatgaaggtgttacg
ttaagacaaaacggaattacccttccaattatggtcatgagtccagaaatttcctcgctg
gaggctatagtgaaacatcagctggaaccagagatttttagtcaatctacattggaggct
tttagtaattacctgcaaaatgcggggataagtaattatcccatccatctgaaattggat
acaggtatgcatcgtttgggatttatgcctgatgaactggactttattgccgattttata
aaaacaaaaaatactgttaaaatacaatctgtattttcgcatctggtagcaagtgagtct
ccgatacatgatgattttactcgccagcaaatttctataataaaggattttacgaataaa
ttggagcaaagaataggttatacttttataaaacatatttgtaatacgtccgctataacc
agatggcctgaagcgcaattcgatatggtgagattaggaatcggattatatggtgtagat
aatttttctgaagatgacgagaatctggaacaggtagctgtattgaaaacaactgtttca
cagataaaacagataaaaaggggagaaaccataggttatggaagaagaggggtaatgcct
gaagacggacaaatagcgactgttaaaataggctatgcggatggtttcttaagagctttg
ggaaatggtgttggaagtatgtttatcaatggcgaggaggttttcaccattggcaacatt
tgtatggatatgtgcatgttaaatataaccgggaaaaatgtaaaagaaggtgatgaagtg
attgtttttaactcgcagaaaagactgtataaattagctgaaaaactaaatactattcct
tacgagatattaacaagtgtatcgcaaagagtaaaaagagtgtattattacgaatag

DBGET integrated database retrieval system