KEGG   Pseudopedobacter saltans: Pedsa_1059Help
Entry
Pedsa_1059        CDS       T01430                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00620  Pyruvate metabolism
psn00680  Methane metabolism
psn01100  Metabolic pathways
psn01120  Microbial metabolism in diverse environments
psn01200  Carbon metabolism
Module
psn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pedsa_1059
  Energy metabolism
   00680 Methane metabolism
    Pedsa_1059
Enzymes [BR:psn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Pedsa_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADY51630
UniProt: F0SBI4
LinkDB All DBs
Position
complement(1261996..1264587)
Genome map
AA seq 863 aa AA seqDB search
MFTFEPRLDSKETVFKNEVKTKFDLYNSLFLTLPFYQVKNTGLALPYFFTHCEKGIINEQ
SPEDIIESFFKKQVGVSDQKEITDLLFRFIQYIERQVVLFDAVEDAAYSKIRVDSETSLD
GLMNNALQNEDLYKKIQDCLREFKLRLVLTAHPTQFYPGPILSIMTDLTEAIKINDVNSI
NLLLKQLGKTPFFNKQKPTPVDEALSLNWFLENILYQTASDVHNKIEEVFKLNLGNHSLI
ELGFWPGGDRDGNPYVTADTTKQVSAALRETLFRCYYKDFGRLKRRITFIGTEQHLVKLE
SILYANAYNNCNNGTNGNIKEELLEILRKVKEVLINNHDGLFTELVDDFIWKVKLFGCHF
ASLDIRQDSRVLRNLFKECITSEELKGQVPENYFELTEEEKIKALPLSQADFTNYKSFNS
LSQDSLDVIRLIKELQENNGKRACHRFIISNCQKASDILQLQQLFLWSGWKPEELDIDFV
PLFETIDDLKNAYGVMDILYSHKIYKKHLDRRRSRQVIMLGFSDSTKDGGYLMANYSIYY
AKSTLTDISRKHNIDLAFFDGRGGPPARGGGKTHKFYASFGRDIANKQIQITVQGQTISS
YYGTFESSTNNMEQLIHAGIDSALERQDTDTMNAEEKALFSDLADVSYDYFMNLREHPLF
LKFMENQSPLKMLSQINIGSRPVKRNGNSELKLEDLRAISFVTSWSQVKMNIPGFYGVGT
ALKSIKEKGNWDKIKALYKEVGFFKTVIDNCMMSMSKADFRLTQYLAKDKTYGEFWQQLK
NEYDLTKELILELSDTNTLMEKNPIDKMSISLREKIVLPLVIIQRYAIIKCTSPDVSEQE
KEIYNKLAMRTIYGIINAARNSA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtttacattcgagccaagattagattcaaaggaaacagtttttaaaaacgaagttaaa
acaaagtttgacctttataatagcttgtttctaaccctacctttttatcaagttaaaaat
accggtttggctttgccatatttctttacgcactgtgaaaaaggtattataaacgagcaa
agtccagaggatattatagagtctttttttaagaagcaagtaggtgtttcagatcaaaag
gagataaccgaccttctttttcgctttatacaatatatagagagacaagttgtattattt
gatgctgtggaagatgctgcctattctaaaatcagagtagatagcgaaacttcattagac
ggccttatgaataatgccttacaaaacgaagatctttacaaaaagattcaggattgttta
agagaatttaaattgagattggttttaactgcgcatccaacccagttttatccgggacca
attttaagtatcatgacagatttgactgaggcaattaaaattaacgatgtcaattcaatt
aatctcttattaaagcagttaggaaaaacacctttcttcaataagcagaaacctacacca
gttgatgaagctttaagtttaaactggtttttagaaaatattctatatcaaaccgcttca
gacgtccacaataaaatcgaagaagtttttaaactgaatttaggtaatcacagtttaatt
gaacttggtttctggccaggaggagatagagatggaaatccgtatgtaacagcagataca
acaaaacaagtatcagctgcactaagagaaactctattcagatgttattataaagatttt
ggaagattaaagcgtagaattacattcattggtaccgagcagcatttggtaaaactggag
tcgatattgtatgcaaacgcatataataactgtaataatggtaccaatggcaatataaaa
gaagaattactggaaattctaagaaaagttaaagaggtacttattaataaccacgacggg
cttttcacagaactagtagacgactttatctggaaggttaaacttttcggttgccatttt
gcttctttagatattcgtcaggatagcagagttttgcgtaacttatttaaagaatgtatt
acgtccgaagaattaaaaggacaagttccggaaaactactttgagctaactgaggaagaa
aaaatcaaagctcttcctttatctcaagctgattttacaaactataagtcctttaactcg
ttaagtcaggattctttagatgttatcaggctaattaaagaactgcaagagaacaatggc
aagagagcttgccacagatttatcattagtaattgccaaaaagcatctgatattcttcag
ttacaacaattatttctttggagtggctggaaacctgaagaattagatatagacttcgtt
ccattatttgagactatcgacgacttaaaaaatgcttatggagttatggatattctatat
tcgcataaaatttataaaaagcatcttgaccgcagaagaagcagacaggtaattatgctt
ggtttttcggatagtacgaaggatggaggttatttaatggctaattactccatttattat
gcgaaatctacgctaacggatatttctcgcaagcataatatagatttggcttttttcgac
gggagaggggggccgcctgctcgtggtggtggtaaaacacataaattttatgcatctttt
ggaagagacatcgctaataaacaaattcagataactgtacaaggacaaacaatcagttct
tattatggaacgtttgaaagctctacaaataatatggagcaattaattcatgcaggtatc
gattctgccttggaaagacaagatacagatacgatgaatgcagaagaaaaagccctgttt
tctgatttagctgatgttagctatgattacttcatgaatttaagagaacatcctttgttt
ctgaaatttatggaaaatcaaagcccgttaaaaatgctttctcaaattaatattggtagc
aggccggttaagagaaatggtaattcggaacttaaattagaagacttaagagcgattagt
tttgtaacttcgtggagtcaggtaaaaatgaacattcctggattttatggtgttggtact
gctcttaaaagcataaaagaaaaaggaaactgggataaaattaaagcgctttataaagaa
gttggtttctttaaaactgtgatagacaattgtatgatgtctatgagcaaagcggacttt
agattgactcaataccttgcaaaagataaaacgtatggtgagttttggcaacagttaaaa
aacgaatacgatttaaccaaagaattaatattagagctttctgacacaaatacgctaatg
gagaagaatccgatagacaagatgtctatctctttaagagagaaaatcgtacttccatta
gtaattattcagcgttatgcaattataaaatgtacttctcctgatgtttctgaacaggaa
aaagagatttacaataaattagcaatgagaacaatttacggaattattaatgctgcaagg
aactctgcataa

DBGET integrated database retrieval system