KEGG   Pseudopedobacter saltans: Pedsa_2380Help
Entry
Pedsa_2380        CDS       T01430                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00020  Citrate cycle (TCA cycle)
psn00310  Lysine degradation
psn00380  Tryptophan metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
Module
psn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pedsa_2380
  09105 Amino acid metabolism
   00310 Lysine degradation
    Pedsa_2380
   00380 Tryptophan metabolism
    Pedsa_2380
Enzymes [BR:psn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Pedsa_2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ADY52928
UniProt: F0SE02
LinkDB All DBs
Position
complement(2762825..2765605)
Genome map
AA seq 926 aa AA seqDB search
MDNLSYLSNADSAYIDSLYQSYKENPQSVDFGWQKFFEGFDFGLQSDADGSVPQPVISGA
TPDHVLKEINVLNMIDGFRTRGHLFTKTNPVRERRKYYPGKELETFGLSDADLDTVFNAG
VEIGLGPAKLRDIYQLLNETYCESIGVEYKYMRNPLKFKWFEERIELSRNKPQFDIEKKK
RILQKLNQAVVFESFLGTKFLGQKRFSLEGAEALIPALDSVIEKGAELGIEEFTIGMAHR
GRLNVLTNIMGKTYKDVFSEFEGKYNKDLPFGGDVKYHLGFSTDVETSSNKKVHLSLCPN
PSHLETVAAVVEGITRSKIDMKYGRDYNRIAPIVIHGDASVAGQGLVYEVLQMSKLDAYK
TGGTIHLVINNQIGFTTNYKDARSSTYCTDIAKVTLSPVFHVNGDDVEALVYAINMAVEY
RQRFHNDVFIDILCYRRYGHNESDEPRFTQPLLYKKIEKHPNPREIYVDKLKAQGAVDAN
LAKQMDKEFRELLQERLNESKEDPGAPENPTYSGAWSDLRISTAKDLVNSPDTSVDEKTF
VQIANKITTLPSDKKFLSKVDRLFSDRKKMIENKSFDWAMGELMAYGTLVNEGRRVRISG
QDVERGTFSHRHAVIRVEESEEQYTPLHHVREGQGPFEIYNSHLSEYGVLGFEYGYAMAN
PYSLTIWEAQFGDFANGAQIVIDQYISSAETKWQRGNGLVMLLPHGYEGQGPEHSSARIE
RFLELCAEDNMQIVYCSTPAQLFHALRRQLKRDFRKPLVNFSPKSLLRNPKCVSSLDDFT
KGKFREVIDDVNVTAKDVKRVAICSGKIYYDLLEEQEKNNRKDVALVRLEQIYPTPFEQL
NAIREKYKNAEFYWVQEEPENNGPWPFICRVFRKSNFDFEVISRRASSSPATGFAKQHVA
EQNEIISKVFNLEGDKITDSKKAKTK
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggataatttgtcatatttaagtaacgcagattccgcatatatagactcgctctatcaa
tcgtataaagaaaatccgcaatcagtagattttggatggcaaaagttttttgaaggcttt
gattttggtttgcaatcagatgctgatggttcagtacctcagccagttatttcaggagca
acaccagaccacgttttaaaagaaattaacgttttaaatatgatcgatggttttagaacc
agaggtcacttgtttacaaaaaccaatccggttagagaaagaagaaaatattatccgggt
aaagaattagaaacattcggtttaagcgatgcagacttagatacagtattcaatgctggt
gtcgaaatcggtttaggacctgccaaacttcgtgatatttatcagttactaaacgagact
tattgcgaatctatcggcgtagaatataaatatatgcgtaatccacttaaatttaagtgg
tttgaagaacgtatagaactttctcgaaataaacctcagtttgatatcgagaagaaaaag
agaattcttcagaaattaaatcaggctgttgttttcgagagctttttaggtactaagttt
ttagggcaaaaaagattctctttggagggagctgaagcattgattcctgctttggattcg
gttatcgaaaaaggagccgagttaggtatagaagagtttactataggtatggcacaccgt
ggtcgtttgaacgttttaacaaacattatggggaaaacctataaagatgtattctcggaa
tttgaaggaaaatataataaagatctgcctttcggtggagacgttaaatatcatttaggt
ttttctacagatgtagaaacttcatctaataaaaaagtacacttaagcctttgtccaaac
ccttcgcatttagagaccgtagcagcggtagttgaaggtattaccagatcgaaaatcgat
atgaaatacggtagagattacaatagaatcgcgcctatcgttattcatggtgatgcttct
gtagctggtcagggattggtttacgaagtgttacagatgtctaaattggatgcctataaa
acaggcggaacaatccatttggtaatcaataatcaaataggatttactacaaactacaaa
gatgcaaggtcttcaacctattgtacagatattgcaaaagtaacgttgtctccggtattc
catgttaatggagatgatgttgaagcactggtttacgcaattaatatggctgtagagtat
cgtcagcgtttccataacgatgtatttattgatattctttgctatagaagatatggtcat
aacgaatctgatgagccacgtttcacacagcctttgttatataagaaaattgaaaaacat
ccaaatccaagagagatttatgtagataaattgaaagcacagggggcagtagacgctaat
ctggcaaaacaaatggataaggagtttagagaattactgcaagagcgtttaaacgagtct
aaagaagatccgggagctcctgaaaatccaacttattctggtgcctggagcgatttgaga
atatctacagctaaagatttagttaattctccggataccagcgttgacgaaaagacgttc
gtacagattgcgaataaaattacaaccctgccttctgataagaaattcctttctaaagta
gaccgcttattctccgacagaaagaaaatgattgagaataaatcattcgactgggcaatg
ggcgagttgatggcttatggaactttggttaacgaaggtagaagagttagaatttctggt
caggatgttgaaagaggaacgttttctcatagacacgcggtaattcgtgtagaagaatca
gaagagcaatatacaccattgcatcatgttagagaaggtcagggaccatttgaaatatac
aattctcatttatcagaatacggtgtcttaggttttgaatacggatatgctatggctaat
ccttattctctgactatctgggaagcacaatttggagattttgctaacggggcacaaatt
gttatcgaccagtatatttcttctgccgaaacaaaatggcaaagaggaaatggtctggta
atgttgttgccacatggttatgaagggcaaggcccggaacactcatccgctaggatcgag
cgctttttggaactttgtgcagaggataatatgcaaatagtttactgctcaactccggca
cagttgtttcatgcattacgcagacagttgaagagagatttccgtaaaccattagtcaac
ttctcgcctaaatcattattaagaaatccaaaatgtgtatcatctctggatgattttaca
aaaggaaaattcagggaagttattgatgatgtgaatgtaaccgctaaagatgtaaaacga
gttgcaatctgttcaggaaaaatctattatgatctattggaagaacaggaaaaaaacaac
aggaaagatgttgctttggttaggttggagcaaatttaccctactccgttcgagcaattg
aacgcaattcgtgaaaaatataaaaatgccgagttctactgggtacaagaggaaccagaa
aacaatggaccttggccatttatttgtcgtgttttcagaaaatcaaattttgattttgaa
gtaatttccagaagagcgagcagtagcccggcaactggatttgcgaaacaacacgtggca
gagcaaaacgaaatcatttctaaagtgtttaacttagaaggggataaaataacagatagc
aaaaaagctaaaacaaaatag

DBGET integrated database retrieval system