KEGG   Pseudopedobacter saltans: Pedsa_2891Help
Entry
Pedsa_2891        CDS       T01430                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00564  Glycerophospholipid metabolism
psn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pedsa_2891
Enzymes [BR:psn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Pedsa_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like Thi4 Pyr_redox_3 GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADY53430
UniProt: F0S8G6
LinkDB All DBs
Position
3442137..3443711
Genome map
AA seq 524 aa AA seqDB search
MKLKTREEQLSNLQENIIWDIVIIGGGATGLGCAVDSASRGFKTLLLEQYDFAKGTSSRS
TKLVHGGVRYLAQGDVSLVREALKERGLLFQNAPHLVNKQSFVIPCFGLFSKIKYLVGLK
LYDWLSGKYSFGSSIYLNKNKVLDRLKGISEKHVSGGIEYYDGQFDDARLAINLAQTAID
HGATVLNYAKVTSLSKGNNSKLNGLTFIDAENQKEYNIQTKSIINATGVFVDDILNMDTP
GRNHLVRPSQGVHLVLDRSFMKGDSALMIPETSDGRVLFAVPWHEHLVVGTTDTPLDSHS
LEPVALQKEINFILETAGAYLEKRPTESDVLSVFAGLRPLAAPDKSTNKTKEISRSHKLI
VSPSGLVTITGGKWTTYRKMAEDTINETIKVCGLEEKSCATEQLKIHGYKAQKEGSYLDI
YGSDALSIKNIIIQQPEFGNKLIDSFPYTAAEVIWFVRNEMARSIEDVLARRLRLLFLDA
KAAVEIAPKVAQLMASEMGYGKEWETQQVNNFNAIASNYILKKK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaaacaagagaagagcagctttctaacctacaagagaacattatttgggat
attgtaattattggcggaggcgcaacaggcttgggctgcgcggtagattctgcctcccga
ggatttaagactttattactggagcaatatgattttgcaaaaggtacgtccagtagaagc
acaaagcttgttcatggaggagtgaggtacctggctcagggagatgtcagtctggttcgg
gaggcgctaaaggagagaggacttctttttcagaatgcccctcatctcgttaacaagcaa
tccttcgtaatcccttgttttggactattttctaaaattaaatacctggtaggtttaaaa
ctatacgattggctatctggaaaatatagtttcggaagctctatttatctaaataaaaac
aaggttttagacagattaaaaggtatttctgaaaagcatgtgtctggaggtatagaatat
tacgatgggcaatttgacgacgcgcgtcttgcaataaatctggcacagacagctatcgat
catggtgctacggtgcttaactatgcaaaggttacatcactaagcaaaggcaataacagc
aaattaaatggccttactttcattgatgcagaaaatcaaaaagaatataatatccaaaca
aaatcaatcatcaatgccactggtgtatttgttgatgatatattaaacatggacaccccg
ggaagaaatcatttggttagaccaagccagggcgttcaccttgttttggacaggtctttt
atgaagggtgattctgcattaatgattccggaaacttctgatggcagagttttgtttgca
gtgccttggcatgaacatttagttgtgggaactacggatacacctttagacagtcacagc
ttagaaccagttgctcttcaaaaagaaataaattttattctggaaactgcgggtgcatat
ttagaaaaaagaccgacagaaagtgacgtattaagtgttttcgcaggtttaaggccgcta
gctgcgccagataaatcgaccaacaaaacaaaggagatttcaaggagccataaattaata
gtaagtcctagcggattggtaacaatcaccggcggtaaatggacgacttacagaaaaatg
gccgaagacacaattaatgaaaccataaaagtttgcggtctggaagaaaaatcctgtgct
acagaacaattaaaaatacatggttataaagcccaaaaagaaggctcgtatcttgatatt
tatggtagcgatgctttaagtataaaaaatattatcatacagcaaccggaatttggaaac
aaattaatcgattctttcccttatacagcagccgaggtaatttggtttgtaagaaacgaa
atggctagaagcatagaagatgtattggcaagaagattacgtttattatttttagatgcc
aaagcagcggttgaaattgctccgaaagttgcacagttaatggcttcagaaatgggttat
ggaaaagagtgggagactcaacaggttaacaactttaatgcaattgctagcaattatatt
ctaaaaaagaaataa

DBGET integrated database retrieval system