KEGG   Psychrobacter sp. G: PSYCG_02670Help
Entry
PSYCG_02670       CDS       T02715                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pso  Psychrobacter sp. G
Pathway
pso00970  Aminoacyl-tRNA biosynthesis
pso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pso00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSYCG_02670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pso03029]
    PSYCG_02670
Enzymes [BR:pso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PSYCG_02670
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PSYCG_02670
Mitochondrial biogenesis [BR:pso03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PSYCG_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGP48098
UniProt: S4Z0L4
LinkDB All DBs
Position
complement(582765..584261)
Genome map
AA seq 498 aa AA seqDB search
MSELHLLSTQQLITGLQDKQFSSLELTDHYIKRINALDSKINSFITHTSETARAQAKAAD
EMRVQGDKRPLLGVPMAHKDIFCTQGVLTTCGSKMLHNFISPYDATIVTNIDKAGMISLG
KLNMDEFAMGSDNESSYYGAVHNPWNIAHVPGGSSGGSAAAVAAGFVPVATGSDTGGSIR
QPASFCGLTGIKPTYGRVSRFGMIAYASSLDQAGSMGRSAMDCAFLLQPMIGHDPRDATS
IKYDMPDYVQDLNDAATSAGDKPFAGLRIGVAKEYFSKGLDTEVEQAARAALKKYEELGA
TIVEVTITDPEITLATYYMLAPAEASSNLSRFDGVRFGYRCENPKDLIDLYTRSRSEGFG
PEVQRRILSGTYALSAGYFDAYYTKAQKVRRIIIKDFEDAFANCDVIASPTAPTAAYKLG
EDLDPATMYLGDVYTIGVNLAGLPALSQPVGLTAAGLPIGLQLIGQYWQESKLLSTAHLF
QQHTDHHLQHSTIAKETV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacttcatttattaagtacccagcagctcattactggtctgcaagacaaacaa
tttagcagccttgagctgactgaccactacatcaaacgtatcaacgcgcttgatagcaag
attaacagttttatcactcatacctctgagacagcacgcgcgcaagcaaaagcggcggac
gagatgcgtgtacaaggggacaaacgcccattacttggcgtacccatggcgcataaagat
attttttgtactcaaggcgtattgacgacctgtggctctaaaatgctgcataactttatc
tctccttatgatgcgaccatcgtcactaacattgataaagctgggatgattagccttggt
aagcttaatatggatgagtttgcgatgggctcggataatgaaagctcatattatggtgcg
gtgcacaatccttggaacatagcgcatgtacctggtggctcatcaggtggtagtgcagca
gccgttgcagcaggatttgtacccgttgcgactggtagtgatactggtggctctattcgt
cagcctgcctcattttgcggcttaacgggcatcaaacctacttatggtcgcgtctctcgc
ttcggtatgattgcttatgcctcgagtcttgatcaagccggtagtatgggtcgcagtgcc
atggactgtgccttcctattacagccaatgattggtcatgacccacgcgatgcgacttct
atcaaatacgacatgcctgattatgtacaagatttaaatgacgcagctaccagcgctggt
gataaaccgtttgccggtttacgtattggtgttgctaaagaatactttagtaaaggactt
gatactgaagtcgaacaagcagctcgtgcagcgttaaagaaatatgaagagcttggcgcg
accattgtagaggtgacaatcaccgatccagagatcacccttgctacctattatatgctc
gccccagctgaagcatcatcaaacctatcacgcttcgatggtgtgcgctttgggtatcgc
tgtgaaaaccctaaagacttgattgacttatatacgcgctcgcgttctgaaggctttggt
cctgaagtacagcgccgtattttgtcagggacttatgcgctatctgctggttactttgat
gcctattatactaaggcacaaaaagtgcgccgcataattatcaaagacttcgaagatgct
tttgccaactgtgatgtgatcgccagtccaacggcgccaacagcggcttataaacttggt
gaagacctcgatcctgcaacgatgtacctaggtgatgtttataccattggtgtcaactta
gcgggtctacctgcgcttagtcagccagttggtttaaccgcagctggattgcctattggt
ttgcaattgattggacaatattggcaagagagcaaattgctctctactgctcatttattc
cagcagcatacagatcatcatctgcaacactctaccatcgcgaaggagacggtataa

DBGET integrated database retrieval system