KEGG   Psychrobacter sp. G: PSYCG_10470Help
Entry
PSYCG_10470       CDS       T02715                                 

Definition
(GenBank) anthranilate synthase subunit II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
pso  Psychrobacter sp. G
Pathway
pso00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pso01100  Metabolic pathways
pso01110  Biosynthesis of secondary metabolites
pso01130  Biosynthesis of antibiotics
pso01230  Biosynthesis of amino acids
pso02024  Quorum sensing
Module
pso_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSYCG_10470
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    PSYCG_10470
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSYCG_10470
Enzymes [BR:pso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     PSYCG_10470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Nup84_Nup100
Motif
Other DBs
NCBI-ProteinID: AGP49575
UniProt: S4YZB7
LinkDB All DBs
Position
2409569..2410216
Genome map
AA seq 215 aa AA seqDB search
MNVLIIDNYDSFTFNLYQYIGEILQTMDSDKQANVIVKRNNEITLADVQAMSLDRIIISP
GPGSPDDPAYFGICAEVIEVMGKTTPLLGVCLGMQGIAHVFGGDVIRASVPMHGKVSAIR
HDSAGIYNDLPQELEIMRYHSLMVQADTLPNCLTVTAVVANDEHNDLDLTESALAGDEIM
GVQHKDYPIQGVQFHPESFATEGAKRLLTNFLLQV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttttaattatcgataattacgactcatttacctttaacctttatcaatatatc
ggtgagatcttgcagacgatggacagtgataaacaagcaaatgtcatcgtcaagcgtaat
aatgaaatcaccttagcagacgtacaagcgatgagtcttgaccgtattattatctcaccc
ggtcctgggtcacctgatgatcctgcctattttggcatttgtgccgaagtgattgaagtg
atgggtaaaacgacgccactattaggcgtttgcttaggcatgcaaggcattgctcatgta
tttggcggtgacgtgatacgcgccagtgtgccgatgcatggtaaagtttcagccattcgt
catgatagtgcgggcatttataacgatttgccacaggagttagaaatcatgcgctatcac
tcattgatggtacaagcagatacgctaccaaattgtttgactgtcaccgcagtcgtcgcc
aatgatgaacataatgatttagatttgactgaatcggcgctggctggtgatgagataatg
ggtgtgcagcacaaagactatccgattcaaggcgtgcagtttcacccagagtcatttgcg
accgaaggtgccaagcgtttattgacgaattttttacttcaggtgtaa

DBGET integrated database retrieval system