KEGG   Psychrobacter sp. G: PSYCG_11080Help
Entry
PSYCG_11080       CDS       T02715                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
pso  Psychrobacter sp. G
Pathway
pso00020  Citrate cycle (TCA cycle)
pso00270  Cysteine and methionine metabolism
pso00620  Pyruvate metabolism
pso00630  Glyoxylate and dicarboxylate metabolism
pso00680  Methane metabolism
pso01100  Metabolic pathways
pso01110  Biosynthesis of secondary metabolites
pso01120  Microbial metabolism in diverse environments
pso01130  Biosynthesis of antibiotics
pso01200  Carbon metabolism
Module
pso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pso_M00012  Glyoxylate cycle
pso_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSYCG_11080
   00620 Pyruvate metabolism
    PSYCG_11080
   00630 Glyoxylate and dicarboxylate metabolism
    PSYCG_11080
  09102 Energy metabolism
   00680 Methane metabolism
    PSYCG_11080
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PSYCG_11080
Enzymes [BR:pso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     PSYCG_11080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AGP49694
UniProt: S4YWF6
LinkDB All DBs
Position
complement(2546313..2547302)
Genome map
AA seq 329 aa AA seqDB search
MSMKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIAPALDALKGVVMELE
DCAFPLLAGVVQTDDATVAFKDVDYALLVGSRPRGPGMERKDLLEANAAIFSAQGKALND
VASRDVKVLVVGNPANTNAVIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAGKTDSTVNDL
KKMIIWGNHSSTQYPDLTASTVNGKPALDLVDRAWYEGTYIPEVQQRGAAIIKARGASSA
ASAANAAIAHVRTWVMGTDENDWVSMGVYSNGEYGIAKGLIYSFPVTCANGDWSIVDGVD
VSSDFSKEKMAATEQELSEERDAVAHLLP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaaacagcctgtacgcgttgccgtgactggtgccgctggtaatatcagctat
gctatgttatttcgtattgcttctggcgagatgctaggtaaagatcagccagtgattctg
caattacttgaaatcgctccagcacttgatgccctaaagggtgtggtcatggaattagaa
gactgtgcattcccattattggctggtgtcgtccaaactgatgatgcgactgtggctttt
aaagatgtcgattatgcgttactcgtaggctcacgccctcgtggtcctggtatggaacgt
aaggatttgctagaagccaatgctgcgattttctcagcgcaaggtaaagcattgaatgat
gttgcaagccgtgatgttaaagtattagtagtaggtaatcctgctaacaccaacgctgtt
atcgctcagcgtaacgcaccggatttagatccacgtaacttcactgccatgactcgccta
gatcataaccgtgcaatggcacagttagctggcaagactgacagcacggttaatgacttg
aagaaaatgatcatctggggtaaccattcatcaactcagtatcctgatttgacggcgagc
actgtaaatggcaaaccggcgttagacttggttgatcgcgcatggtatgaaggtacttat
atcccagaagtacaacaacgtggcgctgcaatcatcaaagcacgcggtgcatcatctgcc
gcttctgctgccaatgctgctatcgcacacgtacgtacgtgggtaatgggtactgatgag
aatgattgggtatctatgggtgtctattcaaacggtgagtatggtattgctaaaggtttg
atttactcattcccagtaacttgtgctaacggcgattggtctatcgtagatggcgttgat
gtgtcatcagatttctcaaaagagaaaatggcagccactgagcaagagctgagcgaagag
cgtgatgcagtagcacacttattaccgtaa

DBGET integrated database retrieval system