KEGG   Psychrobacter sp. G: PSYCG_11730Help
Entry
PSYCG_11730       CDS       T02715                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pso  Psychrobacter sp. G
Pathway
pso00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pso01100  Metabolic pathways
pso01110  Biosynthesis of secondary metabolites
pso01130  Biosynthesis of antibiotics
pso01230  Biosynthesis of amino acids
Module
pso_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSYCG_11730
Enzymes [BR:pso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PSYCG_11730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA Cytidylate_kin2 AAA_16 TsaE Cytidylate_kin AAA_5 dNK AAA_22 AAA_17 RuvB_N ABC_tran APS_kinase RNA_helicase Zeta_toxin CoaE Sigma54_activ_2 AAA_28 AAA_7 Rad17
Motif
Other DBs
NCBI-ProteinID: AGP49821
UniProt: S4YZ06
LinkDB All DBs
Position
complement(2694570..2695130)
Genome map
AA seq 186 aa AA seqDB search
MVEELPSVFLVGPMGAGKTTIGRLLAKQLGRSFVDSDWYIESQTGADIAWIFAKEGEAGF
RERETRAIDELTQQPQIVLATGGGAVMAAENREYLKQRGIVIYLNAPVDVQMARTAKDKS
RPLLQQPNPRKILQGLYSARDPLYREVAHIIMPTGHTYPRHMVNQLLQQLNSFCISTSVD
SEPEKD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggaattaccgtcggtatttttggtagggccgatgggagcagggaagaccaca
atcggcagattactggcaaagcagctcgggcgctcgtttgtagacagcgattggtatatc
gaatcgcagaccggtgccgatatcgcttggatatttgccaaagaaggtgaagcgggcttt
cgagaacgggaaacgcgtgcaatcgatgagctaacacagcaaccgcaaattgttttagcg
actggcggcggtgctgtgatggcagctgaaaatcgtgagtatttaaagcagcgcggtatc
gttatttatctcaacgcgcctgtcgatgtacaaatggctcgtactgcgaaagacaaatcg
cgtcctttattacagcagccaaaccccagaaaaatactgcaaggtttatatagcgcgcgc
gatccattgtacagggaagtagcgcatatcattatgccaacaggacatacgtatccacgg
cacatggtcaatcaattattacagcagcttaactcattttgtatctctacgtctgtcgat
tcagagcctgaaaaagactga

DBGET integrated database retrieval system