KEGG   Psychrobacter sp. G: PSYCG_11840Help
Entry
PSYCG_11840       CDS       T02715                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pso  Psychrobacter sp. G
Pathway
pso00061  Fatty acid biosynthesis
pso00780  Biotin metabolism
pso01100  Metabolic pathways
pso01212  Fatty acid metabolism
Module
pso_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pso00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSYCG_11840
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PSYCG_11840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pso01004]
    PSYCG_11840
Enzymes [BR:pso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     PSYCG_11840
Lipid biosynthesis proteins [BR:pso01004]
 Fatty acid synthase
  Component type
   PSYCG_11840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AGP49838
UniProt: T1EBU2
LinkDB All DBs
Position
2725253..2726488
Genome map
AA seq 411 aa AA seqDB search
MRRVVITGAGIVSCIGHDLATVTEALKQGRSGITFNESYAEHEFKSHVSGSIDHSQLDTS
AIDRKLKRFFSDASLYAYVSALNAIEHAGLSLETINSNPRVGVVASSGGASTENIANAID
AMREKGLRGVGAMAVPKTMGSSVSAALATGLKIQGISYSLTSACATSTHCIGHAAELIQL
GKADVILAGGSEAEHWTQSCMFDAMGAVSTQYNDTPELASRAYDKDRDGFVIAAGGAMVV
VESLEHAEARGANILAEIVGYGASSDGAEMVAPSGEGAVRCMKLALAEAGLESVDYINSH
GTSTPLGDITELKAIAKVFDNDISKVPAISSTKSMTGHSLGAVGAQELIYCLLMLQDSFI
APSINITELDPAAKGFDIVTEKRDVELETLMSNSFGFGGTNATLIIKKFDA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgttgttatcactggagcagggattgtctcttgtatcggacatgatttggct
actgtcacagaggctcttaaacaaggacgctctggcatcacgttcaacgaatcttatgct
gagcacgagttcaaatcacacgtcagcggcagtattgatcactcacagcttgatacctca
gctattgaccgcaaactaaaacggttttttagtgacgcaagcctatatgcttatgtcagc
gccctaaatgcgattgagcacgccggtctatctctcgaaaccatcaatagtaatccacgc
gtgggtgtggttgccagctctggcggcgcgtcaacagaaaatatcgccaatgcaatagac
gccatgcgagaaaaagggttacgcggcgttggtgcgatggctgtaccaaaaactatgggc
agctcagtatcggcggcgcttgctactggtctaaaaatccaaggtatctcatactcatta
acctctgcttgtgccacatcgacgcattgtatcggtcatgctgccgagctgattcaattg
ggtaaagccgatgtgatactggctggtggtagtgaggccgaacattggacacagtcttgt
atgtttgatgccatgggcgcggtcagcactcaatataacgacaccccagagcttgcctca
agagcctatgataaagaccgtgatggttttgttatcgcggcaggtggcgcgatggtggtc
gttgaaagtcttgagcatgccgaggcgcgcggtgccaatatcttggctgaaatcgtcggt
tatggtgccagctctgatggcgcagaaatggtcgcgccaagcggtgaaggcgcagtacgc
tgtatgaagctggcgcttgctgaagcgggtttagaaagcgtagattatatcaatagccat
ggtaccagtacgccacttggtgacatcactgagcttaaagctattgctaaagtatttgat
aacgatatcagtaaagtgcctgctattagctcgactaagtctatgacaggtcatagctta
ggtgcggttggtgcacaagagctgatttattgcttactgatgttacaagacagctttatt
gcaccaagtatcaatattacagaattagatccggctgccaaaggctttgatatcgtcact
gaaaaacgcgatgttgagcttgaaactcttatgagcaatagctttggctttggcggtact
aatgcaacactaatcatcaaaaagtttgacgcttaa

DBGET integrated database retrieval system