KEGG   Phytophthora sojae: PHYSODRAFT_248886Help
Entry
PHYSODRAFT_248886 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
psoj  Phytophthora sojae
Pathway
psoj00020  Citrate cycle (TCA cycle)
psoj00190  Oxidative phosphorylation
psoj01100  Metabolic pathways
psoj01110  Biosynthesis of secondary metabolites
psoj01130  Biosynthesis of antibiotics
psoj01200  Carbon metabolism
Module
psoj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psoj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psoj_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHYSODRAFT_248886
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PHYSODRAFT_248886
Enzymes [BR:psoj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PHYSODRAFT_248886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 20637871
NCBI-ProteinID: XP_009532904
JGI: Physo3_248886
UniProt: G4ZXF5
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MLRCSQMKQALAKSLARPAASRGFAVRSSQPLAGVETSALTSKYTVVDHEYDAVVVGAGG
AGLRAAMGCAEAGLKTACISKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD
WLGDQDAIHYMCREAPEAVRELEDFGLPFSRTEEGKIYQRPFGGQSLEFGKGGQARRTAC
AADRTGHAMLHTLYGRSLAFDTSYFIEYFALDLIMNDAGECVGVMAFNMEDGTFHRFHTN
NTVLATGGYGRAYFSCTSAHTCTGDGTGMALRAGIPLQDPEFVQFHPTGIYGAGCLITEG
SRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRAMTMEIREGRGVGKNKDHIFLHLDH
LPPELLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIATNHMGEVVVPDLDGLP
EPGKLYSDKIVPGLFAAGEAACASVHGANRLGANSLLLTKPGDKKRPMPKDGGLKAIEDV
DKLRYADGSISTAELRLEMQKTMQVDAAVYRTQESLEAGKEKIDEVVPKFNDIKVTDRSL
IWNTDLTETLELRNLLACASCTMHGAEARKESRGAHAREDFTERDDVNWMKHTLAYHSDE
GKTHIAYRAVQDQTLDENECKHVPPFARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgctgctcgcagatgaagcaggcgctggccaagtcgctggcccgcccggccgcc
tcgcgcggcttcgccgtgcgcagctcgcagccgctggccggcgtcgagacgtcggcgctc
acgtccaagtacacggtcgtggaccacgagtacgacgccgtggtggtgggcgctggcggc
gccggcctgcgcgcggccatgggctgcgccgaggccggcctcaagacggcctgcatctct
aagctgttccccacgcgctcgcacacggtggccgcgcagggcggcatcaacgccgcgctg
ggcaacatgtcggaggacgactggcggtggcacatgtacgacacggtcaagggcagcgac
tggctcggcgaccaggacgccatccactacatgtgcagagaggcgccggaggctgtgcgc
gagctcgaggacttcggcctgccgttctcccgcacggaggagggcaagatctaccagcgc
cccttcggcggccagagcctggagttcggcaagggtggccaggctcgtcgtaccgcctgc
gctgcggaccgcacgggccacgccatgctgcacacgctgtacggccgctcgctggccttc
gacacgtcgtacttcatcgagtacttcgcgctcgacctcatcatgaacgacgccggtgag
tgcgtgggtgtcatggccttcaacatggaggacggcacgttccaccgcttccacaccaac
aacacggtgctggccacgggcggctacggccgcgcctacttctcgtgcacgtcggcccac
acgtgcacgggcgacggtaccggtatggctctgcgtgccggtatcccccttcaggaccct
gagttcgtgcagttccaccccacgggtatctacggcgctggttgcctgatcacggagggc
tcgcgtggtgagggcggtatcctgcgtaactcggagggcgagcgcttcatggagcgttac
gcccccactgccaaggacctggcctcgcgcgatgtcgtgtcacgtgctatgaccatggag
atccgcgagggccgcggtgtcggcaagaacaaggaccacatcttcctgcacctggaccac
ctgccgcctgagctgctgcacgagcgtctgcccggtatctcggagaccgctgcgattttc
gccggcgtggacgtgaccaaggagcccatcccggtgctgccgacggtgcactacaacatg
ggtggtatcgccaccaaccacatgggtgaggtggttgtgccggatcttgacggcctaccg
gagcccggcaagctgtactcggacaagatcgtgcccggtctgttcgccgctggtgaggct
gcctgcgcttcggtgcacggcgccaaccgcctgggtgccaactcgctgctgctgaccaag
cctggtgataagaagcgtccgatgcccaaggacggtggtctcaaggccatcgaggacgtg
gacaagctgcgttacgccgacggcagcatctccacggccgagctgcgtctggagatgcag
aagacgatgcaggtggacgccgccgtgtaccgcacgcaggagtcgctcgaggctggtaag
gagaagatcgatgaggttgtgcccaagttcaacgacatcaaggtgacggaccgctcgctc
atctggaacacggacctgacggagacgctggagctgcgcaacctgctggcctgcgcatcc
tgcaccatgcacggtgctgaggcccgtaaggagtcccgtggcgctcacgcccgcgaggac
ttcacggagcgtgacgacgtcaactggatgaagcacacgctcgcttaccacagcgacgag
ggcaagacgcacatcgcctaccgcgcggtgcaggaccagactctggacgagaacgagtgc
aagcacgtcccgcccttcgcgcgtgtctactaa

DBGET integrated database retrieval system