KEGG   Phytophthora sojae: PHYSODRAFT_263017Help
Entry
PHYSODRAFT_263017 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
Organism
psoj  Phytophthora sojae
SSDB OrthologParalogGFIT
Motif
Pfam: SET PHD FYVE_2 PHD_2
Motif
Other DBs
NCBI-GeneID: 20639454
NCBI-ProteinID: XP_009529549
JGI: Physo3_263017
UniProt: G4ZPH6
LinkDB All DBs
Position
Unknown
AA seq 823 aa AA seqDB search
MPPKQVGRPRGRPAAKKRKLEAASDEPKLVKRGPGRPPKQKKPAVAAEPAPEPETEPEVT
VDPETASFLQLLEDDARSLPPSPPPLPKRRGFAKSPPEKRVVEFQLPFKDAEIKSLEERQ
WVRRPPPFGRISRCVYVSTKMPVADFPVHKCTCYEEIHKSTTKRTTMMASAKAQKELETN
RGHADVEKHHEAEDVVYCGEGCYNRMLFISCSDETCSAPDLSMCSNRAIKRRELKSVRVE
YIPGPGFGLVANEKINAGEFIIEYVGEVIDDIECERRMIQYRDNGEVNFYMMELEKNIVI
DAKYRSNDSRFINHCCDPNSVTQKWNVDGMQRIGIFARRNIAPDEEITIDYNFSHFGEAA
DCKCGSTACTGKLGVKRSKLPSFNPRVVGTAKAKKQVLVDETPPELKRPVHLTSLALLKS
SQMDESWLDYYGLKYCRLFLSHRPRRQKKEDDKEVNTGEVHRRLPSCSPASECSTTTEED
VSLTPPQAIAKSDLIEKRPHQKNWYEKVTAGEHLPEMRALHSYICGGKSDWSAVLQVDHC
SESEVAANSPSPLKKRGPGRPPKKRSRPRNGGSMFVPSKRAPTGAKLIRTRLGLSQARAR
GIAELAAFANGKSKWNKRIPSSSSINPDRIHRLIDRIKGKQMYIKSDQNDLNEDACFRCG
LAGELICCDGCPAAFHLNCTNLAMVPPDGIPWFCSECTNPRHLQKAPKTTDAGIVAANGT
RSSNRAKLTDYASRHLRTHAAPQVPSLKKIFHSTVPHAKRRYKKRHKATDRSYRELEHMP
LPVWNESDESGAEHATHLSIRVVAPTHNFHELLICTCTRLSTL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaagcaagttggccgaccccggggccgccccgccgctaagaagcgcaagctg
gaggcagccagcgacgagcccaagctggtgaagcgcggcccaggtcgaccgcccaagcag
aagaagcccgcggtcgctgcggagcctgcgcccgagcctgagaccgagccggaggtgacg
gtggacccggagactgcgagcttcctgcagctcctggaggacgacgcacgaagcctgcca
ccctctcccccgccgctccccaagcgtcgcggattcgccaagtctccgcccgagaagcgc
gtcgtggagttccaattgcccttcaaggacgcggagatcaagagcctcgaggagcgccaa
tgggtgcgccgcccgccgcccttcggcaggatcagccgctgcgtctacgtgtccacgaag
atgcccgtggccgacttccctgtacacaagtgcacgtgctacgaggagatccacaagtcc
acgaccaagcgcacgacgatgatggcgagcgccaaggctcagaaggagctcgagaccaat
agaggacacgctgatgtggagaaacatcacgaagcggaggacgtggtgtactgcggtgaa
ggttgctacaaccgcatgctgttcatcagttgctcagatgaaacgtgctctgcgccggac
ctgagcatgtgcagcaaccgagcgatcaagaggagggaactcaagtcggtgagagtggag
tatattcctggacccgggtttgggctcgttgccaacgagaagatcaacgctggagagttt
atcattgaatacgtcggcgaggtgattgatgacatcgagtgcgaacgcagaatgattcag
tacagggataacggcgaggtgaatttctacatgatggagctggagaagaacattgtgatt
gacgccaagtaccgcagcaacgactcgcgtttcatcaaccactgctgtgatcccaacagc
gtcacgcagaagtggaatgtggacggcatgcagcgtattggaatttttgcgcgccgcaat
attgcacccgacgaggagatcaccatcgactacaacttctcccacttcggtgaagccgcc
gattgcaaatgtgggtctacggcgtgcacaggcaagctgggcgtcaagcggtcaaaatta
ccctcgtttaatcctcgtgtggtaggcaccgcgaaggcgaaaaagcaggtactggtggac
gagacgccgcccgagcttaagcgccccgtgcacttgacctccctggcgctgctcaaaagc
tcacagatggacgagagctggctggattactatggactcaaatactgccgattgtttctc
agtcaccgaccgcgccggcagaaaaaagaggacgataaagaagttaacaccggcgaagtt
caccgtagactaccgtcatgcagcccggcctcggagtgctccacaacgaccgaggaggat
gtttcactcacgccgccacaagcaattgctaagagcgatctcatcgaaaagcgaccacac
caaaagaattggtacgaaaaggtcacagcaggggaacacttgcccgagatgagggcacta
cacagctacatctgcggtggcaagtcagactggtcggcggtccttcaggtcgaccactgc
tcggagtcggaagtggcggcgaactctccttcgccgctaaagaagaggggaccgggccgt
ccacccaagaaacgcagtcgtccgaggaatggggggtccatgttcgttccatctaagcgt
gcccccaccggagcgaaacttatccgcactaggcttggtctctcccaagcacgagcaaga
ggaatcgctgagcttgcggcgtttgcaaatggcaagtccaagtggaacaagcgcatcccg
tcgtccagctcgatcaaccccgatcgcatccatcgcctcatcgatcgcataaagggcaag
cagatgtacatcaaatccgaccagaatgacctgaacgaagacgcttgcttccgctgcggc
ctagcgggcgagctcatttgctgtgacggttgccctgccgccttccatctcaactgcacc
aacctcgccatggtgccccctgatggcatcccatggttctgctcggagtgcaccaaccct
cgacaccttcagaaggcaccgaagacgaccgacgctggcatcgtcgctgctaatggcaca
aggagcagcaaccgcgccaagctcactgactacgctagccgacacctgcgcactcacgcg
gccccgcaggtcccaagcctcaaaaagatcttccactccaccgtgcctcacgccaagcgc
cgctacaagaagcggcataaagccacggaccgttcctaccgcgagctggagcacatgccg
ctccccgtgtggaacgagagcgacgagagcggagccgagcacgcgacccatttgtccatt
cgggtggtcgcgcccacgcacaatttccatgagctgttgatatgtacctgcacacgactg
tcgacactgtag

DBGET integrated database retrieval system