KEGG   Phytophthora sojae: PHYSODRAFT_292952Help
Entry
PHYSODRAFT_292952 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
psoj  Phytophthora sojae
Pathway
psoj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PHYSODRAFT_292952
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psoj01001]
    PHYSODRAFT_292952
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:psoj03032]
    PHYSODRAFT_292952
   03400 DNA repair and recombination proteins [BR:psoj03400]
    PHYSODRAFT_292952
Enzymes [BR:psoj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PHYSODRAFT_292952
Protein kinases [BR:psoj01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   PHYSODRAFT_292952
DNA replication proteins [BR:psoj03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     PHYSODRAFT_292952
DNA repair and recombination proteins [BR:psoj03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    PHYSODRAFT_292952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT FATC Oscp1
Motif
Other DBs
NCBI-GeneID: 20640923
NCBI-ProteinID: XP_009513948
JGI: Physo3_292952
UniProt: G4YLQ3
LinkDB All DBs
Position
Unknown
AA seq 3520 aa AA seqDB search
MAARSERDAEWRKFFALCSELRAVKNTKGVSGAVDKLQSFLNDDRTRQLVHRWRSWGYLL
NCLLHVLKEEMRAYLNLGGAGRKRKASARPKMPQLRYWHYLRTELETAHAAADGPMLHLD
PNGRDCICQLFAFSAAVIDRRTPIEFDRNFETQVDKEAWLTVEVLVQYRVYCAVLDYKDW
ENMLEVAMGTISPTLHQDLLGDAATAATRARVIRFLVKNCPFDLTQRDSERHVLEGVVLE
IESWFEAAKSETMEKEADSLLLVVASALMETLTDLMKTYFGSMGPYMLKSGVTVLDFIVI
SNKARKNKLRGAPAEFLMQFLKLYQHNVAAEPEFCYLPPAKLLREMKKLVHVAMGAEEIN
LLMTHFNSAREQRLGNALGIDDQGIRHLACTADIIFYHDCLVSECMQNSEVLAQDEELFD
PVVVGSKRPRSISTVLAWETVIEQFLDSPRTDTQYMTAGRSASPASQRQSSTVSYLSRSF
SSQVQRTEAKQTSDSGAWLLLLLSILSRHGDYYVMNRIGDLMMVMQKLADMLVVKEMGKW
QALTLQILIQMAALSARHREECGDNFVDHWANVWHNLLRPELPYSRVTEGIGLTRGQAGD
AVLTLINCCVSFRLVPLNTIEASSPDLWNLPAFRQPSSDTPPARGDKMRPYARTSMASIC
TLRSLLRHVQLPAEADIGAAVSQTQDSQIIGEEVFEKEYETVQSRLLRSLFDHIRAQVFR
RNTTLAGGLSKSVTKVDWQTEMSTMIYASAIQSFFGTRGSEQLSTKEAIFTPELIRKISA
TDVEECDSYITGEELNGFGVAFCMLECGLEHLSTPFPLSAGVKPAAFALPIQARVNENVG
SGGTCWYDGINSCAAMVDDHFERLATPTGLLYELIPRQDANHLLARDSFWQDHYAQSIST
ERAVALQTEIVNLFSDLLLEISSRLPSDGYNSVKGLRVLANSLDVGLVLAALYADEEGLW
SENAATNEGRLCVLPLLKQYFEIVANYLKPSVIKQAQLSQSMSESVVHILRRLHTIILVS
QGRKTLERCRHPSADPIDLRTPPDLRPSIRAIVNTLEESLACFSGGSDTPGVESPTPMPP
RPRTGFSSLRGASRWESTLSRSSASQHQSQSTHREWDVMDDGEEDDIARDRPPNPVPQKS
IALWCFRVILLLKKDSGLSSVKKYVQAIQFDPDFVLAVAVLLCGVTGADSLEAFVKLIDY
AAEEGIRENRTLSATRGGNCRGGIFLAQVLSALLLAGLVHETRKYQHDEQPPAILVECAK
RHLETAAAITPKQSLRMTRNAELQCLEVFFRLNSREFKSFEETCVAGLTDSDTSVRFIAA
RSLQSVYYMYPEGGEGICRHFFKVQGSLLDAPSLLDIADEAPADTEEHRRRARRERVDSR
LCMDACLCVLQSLYVSACSSQTALPGVLDACVELASITVSLYGAGTPSLISVWLKAIADF
YGYGSVSDLLDDHFCGLWHNFIAASHRPAPQDEDKEDSTGWMKSTPFAPLPHGNALLQQF
PLSALLGKEIDANKRRLEFLKKLDMIFPIGVLHNFISGDSAEVKGGRFEFVDQLVSSFSP
GSESSDDQPEYAISHFGEQVTTDLFAFSFILLAHPDPALKQLAHNMVEVAEERAQASALS
FSHLGHIASKMARFTVWSIIQGNDDELISQSDLWKDALKAMKEKYSEFDWKLVNMADLLS
DFYVLLLRTELYDPRAICAVECFKIFVVETRDAVAEKPVLQHLLLSICFQSIKHLAVRNR
RAIGRVMSLLVRECCECFMKKSDMFGKYLGFVVQEISDILSKCSTQLQRETTAAPLEATT
SRQVYYLSADDQAELEWVIFAVCNDLGSGLGKYALDIDIVPDGISTSLDKLNGLIISSRK
IVSSEDSPNAAKLKSHDPPHPTADRHHQAKQQIQMFIQREHSRGTKFYNPLPFGGSLSIG
PEKPHCGTSSDRPTGSHADMRLSAVTTSIDTLRDSSPSTRKLYGKLAHTLLYLTSSGTFG
SDDRLRETGTANLADALGELGALDASEYELSPAQQEGNLSRLYRQHFHRGALRETKTTFR
LAMHENVLTYLSSLFFEGRRSGNVDPSVLEETLKTLKCVLNLDEGVAALARSKDTELKAF
LEPFETASPSNWSTTPPRNGVGWDLQPKCTFRQQLDRWTSAEVHGFESWVCSLTSSLARE
SPDPVLKACSALSAMRVDMAVFLFPYAVESILRKPDDENTEEIDDTKEATATQDLSRAVK
AVNQGVRFVLTGTTNDALENHVAASTGKFQATEASSQPPQVVQLVVHTINFLRETEKARF
VETNGRTQKKVGAGKGKGSKRSSTGAATGFPNSNDLAYDCMVDVDLLSVARAAVRVNMPY
SAMQYVEMWLEKRNGGKITSLSSLDNDDIVTTLREILVEAYSVDSDSDGIYGVNDGRTVK
SQLVKYNREGKYAKALPLYDISLQFSNQHDLQRGGTAIIVSNRLVEGMLTSLQSLGYNHL
LEGYLQSLQQSGQFSSRSSGFAAAQALEHKYQLAWKRMQWEAVLPTISLPDGKDPATTSF
SHQPMLFQGLRAIAHGDFKSLQRVTSKAKEQILQSVQLSLHSFESTKDSYSALGYLQGIH
ELEELADYIRRSSSVADSPILSTMTPTGLKSYSSLDDVLDVSRQKSLTTMSLLERWQRRH
DQIKNDFDKAESLLGLEEVLLQVSKASDEAKVLTKLYLDLASLSRKAGRIAVAYRALSKL
EQLDDRGSLGIFDKMQWQIQKAKLLWKQQEARSAIWTGKKLCSDLTAYLDGSSVSGAEAA
SLQLLHVKVLTITGKWIASQRSESSQVILEEFFQKATEIIRGIASEAVSERAGDASKAHF
ALAEFMAAMYQQVSTRVTSREWLAGKKVVQARHDELLELQSMKQNMQNENRAHIHALNKE
VVYDLNERSKVEASVDQFLMGALCSYGKGLSLSPQPELDMVFRVLSLWLNNQHKADINRV
VIEEVIDMVPSYKFVPLSYQIISRISSSTDTGTFQTALRKLVMKMSEQHPHHTLIQLIAL
KNSGDVEGKGALQFRTNVGDAKAEGAKVYLAELMKTEQRELLESLDCMANAYVQLALFDT
SEYHGQKKKIPLSKVTIFDTSSSSGRSGAAPFDAYIRARTRRGGSAVIPAVLTSRIVPQA
DMDYSGVVRTFSFESHFSITDSGIHRPKIIYCHGSDGQSYKQLVKGQDDTRQDLVIEQVF
ETMNQFLMEEKATRKRKLRLRTYRVVPLSPIAGVLEWVENTTPWGSYLVSRTSKRLSAHE
RYHPHEWKHTECRQYLKNAPEKLPAFLEIQANFTPVFHHFFLEKFPDAAVWYHRRLAYVQ
SAAVTSIVGYILGIGDRHSQNILIHEETGELVHIDFGVVFDQGMALYTPETVPFRLTRDM
VDGMGISGVDGVFSRCCEVTLQLLRKKSASVVTILEVFVHDPLYRWTLSPLKALRIQEGG
EQDRRKSDARSRGSSRSGSSYGVTGTGSTNEAQPADEMHAEPGSTDAAARALIRVKQKLE
GYEDPNGSALSIEGQVKQLLSAAQDPHNLCKLFPGWAPWL
NT seq 10563 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccgctcggagcgcgacgccgagtggcgcaagttcttcgcgctgtgcagcgag
ctgcgcgccgtcaagaacaccaagggcgtgtcgggcgccgtggacaagctgcagagcttc
ctgaacgacgaccgcacgcgccagctcgtgcaccgctggcgcagctggggctacctgctc
aactgcctgctgcacgtgctcaaggaagagatgcgcgcgtacctgaacctgggcggcgcc
ggccgcaagcgcaaggcgtcggcgcgccccaagatgccgcagctgcgctactggcactac
ctgcgcacggagctggagacggcgcacgcggcggcggacggccccatgctgcacctggac
cccaacggccgcgactgcatctgccagttgttcgccttctcggcggccgtcatcgaccgc
cgcacgcccatcgagtttgaccgcaacttcgagacgcaggtggacaaggaggcctggctc
acggtcgaggtgctcgtgcagtaccgcgtgtactgcgccgtgctggactacaaggactgg
gagaacatgctggaggtggccatgggcaccatctccccgacgctacaccaagatctgctc
ggagacgcagctacggcagccactcgcgccagggtgatccggttcctggtcaagaactgc
cccttcgacttgacccagcgcgactcggagcgccacgtgctggagggtgtcgtgctggag
attgagagctggttcgaagcggccaaaagtgagacgatggagaaagaggctgatagtttg
ctgctggtcgtcgcctcagcgttgatggagacgctcacggacttgatgaagacgtatttc
ggatccatggggccctatatgttgaaaagcggagtcacggtgctggattttattgtcatt
tcgaataaagctcggaagaacaaacttcgaggggcgccggcagagtttttgatgcagttt
ttgaagctgtaccagcataatgtggctgcggagccggaattctgctatctgccaccggcg
aagctgctgcgcgagatgaagaagctggtccatgtggcaatgggtgcggaggagatcaac
ctcttgatgacacacttcaactcagcgagagaacagcgactggggaatgccctcggtatt
gatgatcaagggatacggcacttggcttgcacggcagatattattttctatcacgattgc
ttggtgtcggagtgcatgcagaacagtgaggttttggcgcaagatgaagagttatttgac
ccagtcgttgtcggtagcaagcgacctaggtccatctcaacggtgctcgcatgggagacg
gtcatcgaacagtttttggacagcccgcggacggacactcagtatatgacagcaggcaga
tctgcttcacccgcatcgcagcgacagtcttcaactgtatcttacttatcgagaagtttt
tcgtcccaagttcagcgaaccgaagccaaacagacgagtgactccggggcgtggttgctt
ttgctcctgtccattttaagtcgccacggagattattacgtgatgaatcgaattggagac
ttgatgatggtcatgcagaagctcgcggatatgctggtggtcaaagagatgggcaagtgg
caagcactgactttgcagatactgattcaaatggctgctctctcggcacggcaccgtgaa
gagtgcggtgacaattttgttgatcattgggcgaacgtatggcacaacttgcttcgaccc
gagcttccgtacagtcgtgttacagaaggaatcggattgacgcgagggcaagcaggcgat
gctgtacttacgctaattaactgctgcgtttcattcaggctcgttccgctgaataccatc
gaagcaagcagtccagatttatggaatctgccagcatttcgacagccgagctcagacacg
ccaccagcacgcggagataagatgcgaccttacgctagaacgtcaatggcttctatctgc
actttacgttcgcttcttcgtcacgtgcagttaccggcggaagctgatatcggtgcagca
gtatcgcaaacacaggattcccaaattattggcgaagaagtgtttgaaaaagagtacgaa
acggtgcagtcgagacttcttcgatcgctgttcgaccatattcgtgcacaggtgtttcga
cgcaacacgacattggcgggtgggctatccaagtccgtcactaaagttgattggcagaca
gagatgtccacgatgatctacgcttctgccattcagtcattcttcggaacaagaggttct
gaacaactgagcacgaaggaagcgatttttactccagaattgatccgcaagatatctgca
acagatgtggaggagtgcgatagctacatcacgggggaggaactcaacggctttggagtg
gctttctgcatgcttgagtgtgggctcgaacatctttcaacacctttcccactatcagct
ggtgtaaagccggcagccttcgccctaccgattcaagcgcgcgttaacgaaaacgtcgga
tctggtggtacatgctggtacgatgggattaactcgtgtgcggcaatggttgatgaccac
tttgaacgtcttgcgactccgactggtcttttgtacgagttgatcccacgacaagatgca
aatcacttactcgctcgtgatagtttttggcaggaccactatgctcaatctatttcgaca
gagagagcggtggcgctgcagacagaaatcgtcaatttgttctccgacttgctattggaa
atctctagcaggttaccctccgacggatacaattcagtcaagggattgcgcgtgctagct
aactcacttgacgttggccttgttcttgctgcactttatgctgatgaagagggtttgtgg
tcagaaaacgccgcaacgaacgagggtcggctctgtgtgcttccactgctgaaacagtac
ttcgagattgttgcaaactatttgaagccaagtgtgatcaagcaagcccagctaagccaa
tcaatgtctgaaagcgtggtgcacatactacgacggcttcatacgatcattctggtgtct
caaggtcggaaaacactggagaggtgccgtcatccgtcagcagatcctattgatttacgt
acacctcccgatcttcgcccgtcaataagagctatcgtgaatacgctagaagagtcacta
gcttgcttcagtggcggtagtgatacgccgggggtggagtcccctacgccaatgccgcca
cgtccgcggacaggatttagctcgcttcgcggtgcttcccgctgggagtctactttgagc
cggtcgtccgcttctcagcaccagagccagtcaacacatagagaatgggatgtcatggat
gacggggaggaagatgacattgcacgtgaccgccctcccaatcctgtgcctcaaaagagt
attgcgctgtggtgtttccgcgtgattttacttctcaagaaagacagtggcctctcgtcg
gtgaagaaatatgtacaggcgattcagtttgacccggatttcgtcctggcagtcgctgtt
cttttatgcggagtaactggcgctgacagcctggaagctttcgtcaaattgatcgattat
gctgcagaggaaggcatacgagaaaaccggacgctttcagctacacgtggtggaaattgt
cgaggagggatatttctcgctcaggtgctgtctgcattgctccttgctggtttggttcat
gaaacgcggaagtatcagcatgatgaacaacctccggcgattcttgtggagtgcgcaaag
agacacctggagactgcggccgcgattacgccaaagcagagcttgcgcatgacgcggaac
gccgagctgcagtgcttggaggtattttttcgtctaaattcccgggaattcaaatcgttt
gaagaaacatgcgtagctggattaactgacagcgacacgagcgtgcgctttattgcagcg
cgcagtctgcagtcagtgtattacatgtatccagaaggcggtgaaggaatatgccgacac
tttttcaaggtacaggggtcgttactagatgcaccctcgctgctggatattgcggacgaa
gcccctgctgataccgaagagcatcggcgacgtgcgagacgagaacgtgttgattcacga
ctgtgtatggacgcatgcctgtgtgttttgcagagcttgtatgtgagtgcctgctcgtca
caaacagcgcttcctggggttctagatgcatgtgtcgagttggcatcaataacggtgtca
ctgtatggtgcgggcacaccgtcgctgatttcagtgtggttaaaagcgattgcagatttt
tacggatatggaagtgtgtccgatttgctggacgaccacttttgcggtctgtggcacaat
tttatagctgcaagccatcgaccagcgcctcaagacgaagacaaagaggatagcacggga
tggatgaaaagcaccccatttgcccctcttccacatggcaacgctttactacagcagttc
ccactctctgcgcttctcggcaaagagattgatgctaacaagcgtcggttggaattcctg
aagaaactggatatgatttttccaattggagtgctacacaacttcatttctggagacagc
gccgaagtgaaaggtgggcgatttgaatttgttgatcagctcgtgtcgagcttctctcct
ggcagtgagagtagtgacgatcagcctgaatatgcgatatcgcattttggtgagcaggtg
accacggatttgttcgccttttcgttcattttgttggcccatcctgatccggccctgaaa
caattagctcataatatggttgaggtggcggaagagcgtgcccaagcgagcgcgctatca
ttttcgcatttaggccatatagcaagcaaaatggcgcgttttacggtgtggagcattatt
caagggaacgatgacgaattaatttcccaaagtgacctgtggaaggacgcactgaaagcc
atgaaagagaaatactcggagtttgactggaagctcgttaatatggccgatttactcagc
gatttttacgtgctcttgctgcgaacggaactctacgatccgagggccatatgtgcagtg
gagtgcttcaaaatctttgtagtggagactcgtgacgcagtagccgaaaaaccagtgctg
caacacctgctgctatcgatatgttttcagtcgatcaagcatttggctgtcaggaatcgc
cgtgcaatcggaagggtgatgtctctcctagttcgcgaatgctgcgagtgtttcatgaag
aagtctgacatgttcgggaagtatctcggattcgtagtgcaagaaatcagtgatattctg
tccaagtgcagcacgcaattgcagcgagaaacaacagcggcgccactggaagcgacaaca
tcgcgacaggtatattacttgagtgcggatgaccaagcggagctggagtgggtcattttt
gcggtgtgcaacgatctaggcagcggactcgggaaatacgctcttgatatcgacatagtg
ccggacggtatatccacgagtctcgacaagttaaacgggctaatcatcagcagtcgaaag
atagtttcatccgaagacagccccaatgcagccaagctcaaatcacacgacccaccccac
cccactgcggatagacaccaccaagcgaagcagcagattcaaatgttcattcaacgtgaa
cattcgcgtgggaccaagttctacaacccgttaccgtttggcggatcactaagtattggc
ccagagaagccgcactgtgggacttcctctgaccgtccaactgggtctcatgccgatatg
cgcttatccgccgttacaacaagcattgacacactgcgagactccagcccatcaaccagg
aaactgtacgggaagcttgcccatacattactttatctcacctcctcaggcacatttggc
agtgacgaccgcctccgtgaaacaggaacagcaaaccttgcagatgctttaggcgagctc
ggagcgcttgatgcaagcgagtatgagctgagtccagcccagcaggaagggaatttgtca
cggttgtatcggcagcactttcatcggggtgcactccgagaaaccaagacaacatttcgg
cttgctatgcatgagaacgtgctgacgtacttgagctcattgtttttcgagggaaggcga
tccggaaatgttgatccgtcagtgctggaagagacacttaagacactaaaatgtgttctg
aatcttgatgagggagtggctgctttggctcggagtaaggacactgagcttaaagcgttt
ctggagccattcgagaccgcgtcaccatcgaattggtcgacaacgcccccaagaaacggt
gtaggctgggatctacagccgaagtgtacatttcgtcaacaattggatcgttggacatcc
gcggaagtgcatggctttgagtcgtgggtgtgttccttgacctcaagcctggctagagag
tctccggacccggtgttgaaggcgtgctcggccttgtcagccatgcgggtagatatggca
gtattcctcttcccctacgctgttgaaagcattttaaggaaacccgacgatgaaaacact
gaagagattgatgacacgaaggaggctaccgctacacaagatctttcccgagcagtgaag
gctgttaatcaaggcgtgcgatttgtgttgacggggacaacaaatgacgcactggaaaac
catgttgcagcctcaacggggaaattccaagcaacagaagcaagttcccagccacctcaa
gttgtgcagctcgttgttcacactatcaatttcctcagggaaacggagaaagctcgtttc
gtggagacaaacggtagaacccagaaaaaagttggagcaggtaaaggaaaaggctccaag
cgatcatccactggtgctgcaacagggttccccaactcgaatgatctggcgtatgactgc
atggttgacgtggaccttctttcggttgcaagggctgccgtacgagttaacatgccgtat
tcagctatgcagtacgtggaaatgtggttggaaaaacgtaatgggggaaaaatcacttcg
ctgtcgtcgttggataacgatgacatagtgaccacattgcgtgaaatcctcgtcgaggcg
tacagcgttgacagcgacagcgatggtatttatggtgttaacgatggacgaacagttaag
tcacagttggtcaaatacaaccgcgagggtaagtacgccaaggctctgcccctctacgat
atctccttgcagttttcaaaccagcatgatctgcaacgtggaggcactgcaatcatcgtc
tccaatcggcttgtggagggcatgcttacgtcactgcaatcgcttgggtacaatcacttg
ctggaaggctacttgcagtcactgcagcagagtggccaattttcgagtagaagttctgga
tttgctgctgctcaagccttagagcacaaatatcagctggcatggaaacgcatgcagtgg
gaagctgtgcttcccacgatttcgctgcctgatggcaaggacccagcaactactagtttc
tcgcaccagccaatgctctttcaaggattgcgagctatagctcacggagatttcaaaagt
ctgcagcgcgtgacatcaaaggcgaaggagcagatcttgcaatcggttcagctgagtttg
cactcgtttgagagcacgaaagattcgtactcggcacttggttacctgcagggtattcac
gaacttgaagaattggctgactacattaggagatcaagctcggtggcagattcgccgatc
ctgtcgactatgacacccaccggattgaaaagctactcgtcgttggatgatgtccttgat
gtttcgcgacaaaaatcattgacaacaatgtcgctgctagagcgatggcaaaggcgacat
gaccagatcaagaacgattttgacaaggccgaaagcctgttaggtctggaagaagtactt
cttcaggtgtcaaaggcatctgatgaagcgaaggtactgacgaaactgtacctggacctg
gcttcactcagccgcaaagctgggcggattgcagtggcatatcgagccttatcgaagctt
gaacagcttgatgatcgtgggtccttgggcatttttgacaaaatgcaatggcagatacaa
aaggccaaactgttgtggaagcagcaggaagctcgcagtgcgatttggaccgggaaaaaa
ttgtgctccgacttaaccgcatatttggatggttcttctgtttctggggccgaagcggcc
tccttgcaactgctgcacgtcaaggtgctgacaatcaccggtaaatggattgcatcgcag
cgttctgagagctctcaagtgattctcgaggagttctttcaaaaagctactgagatcatt
cgcggaattgcttctgaagcagtctcagagcgggctggagatgcatcaaaggctcatttt
gctctggccgagttcatggctgcgatgtaccagcaagttagtacacgcgtgacgtcgcgg
gagtggctggcaggcaaaaaagttgtccaagcacgacacgacgaactgctagaactgcag
agcatgaagcagaacatgcaaaacgaaaatcgagcgcacattcacgcactgaataaagag
gttgtttatgacctcaatgagcgctcgaaagtcgaggcttcggtcgatcaatttctgatg
ggggcgctgtgcagctacgggaagggactatcgctgtcgcctcaacctgagctcgatatg
gtgtttcgtgtactttcgctatggctgaataatcagcacaaggccgacatcaatcgagtt
gtgatagaagaagtgatcgacatggtgccgtcgtacaaattcgtgcccctgtcgtaccaa
atcatctcacgtattagcagctccaccgatactggaactttccaaactgctctgcgcaaa
ctggtgatgaagatgagcgagcagcacccgcaccatacactgatacaattgattgcgtta
aagaacagcggagatgttgaagggaagggtgcgctacagtttcgcacgaacgttggagac
gcaaaagcagaaggtgccaaagtgtatttggccgagttgatgaaaacggagcagcgggag
ctactggagtctctcgactgcatggcaaacgcgtacgttcagttggcactgtttgacaca
agtgaatatcacggccaaaagaagaagattccattgtcgaaggtgacgatctttgataca
agctcaagctcaggaaggtctggagccgcgccgtttgacgcatacattcgtgcccggaca
cggcgtggtggctctgctgtaatcccggcagtgcttacctctcgcatcgtaccgcaagca
gatatggactactccggcgtggtacgaacgttctcatttgagtcgcatttttccattacc
gacagcggaatccatcggccgaagataatttactgccacggctcggatggccaaagctac
aagcagctggtgaaggggcaagatgacacgcgacaggaccttgtcattgaacaagtgttt
gaaacgatgaaccagttcctgatggaagaaaaggcgactcgcaagcgtaaattgcgactg
cgcacgtacagagtggtcccgctgtctccgattgcaggcgtgctggaatgggtggagaac
actacaccttgggggtcctatctggtgagtcggacatccaagaggctgtcggcgcatgag
cgataccaccctcatgaatggaagcacacggaatgccgacaatacctgaaaaatgctccg
gagaagctgccggcctttttggagatccaggcgaattttactccagtcttccaccacttc
tttttagagaaattccccgatgcagcagtatggtaccatcgtcgactagcttacgtccag
agcgccgcggtgacgtccatcgtcggatacattctgggcatcggagatcgccattcgcag
aacatcctcatccatgaagagacaggagagctcgtgcacatcgactttggcgtcgtgttt
gaccagggaatggcgttgtatacgcccgagactgttccattccgactcacacgcgacatg
gtcgatggaatgggcatttcaggcgtagacggcgttttctcgcgttgctgtgaagtcacg
ttgcaactcttgcgcaagaagagcgcctcggtcgtgacgattctcgaggtctttgtgcac
gatccactctatcgatggacactctcaccattgaaggcactgcgcattcaagagggaggg
gaacaggatcgcaggaaatctgatgcacgttcgcggggttcgagccgctctggtagcagc
tacggtgttactggaaccggcagtacgaatgaggcccaaccagctgatgaaatgcatgcg
gagccgggaagtactgacgctgcagctcgagctctaattcgcgtcaagcagaagctcgag
ggctacgaggacccgaatggaagtgctctgagcatcgagggccaggtaaagcagctcctg
agtgcagcacaggacccacacaacttgtgcaaactctttccagggtgggctccctggctg
tag

DBGET integrated database retrieval system