KEGG   Phytophthora sojae: PHYSODRAFT_294767Help
Entry
PHYSODRAFT_294767 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
psoj  Phytophthora sojae
Pathway
psoj00562  Inositol phosphate metabolism
psoj01100  Metabolic pathways
psoj04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PHYSODRAFT_294767
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    PHYSODRAFT_294767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:psoj01009]
    PHYSODRAFT_294767
Enzymes [BR:psoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PHYSODRAFT_294767
    3.1.3.48  protein-tyrosine-phosphatase
     PHYSODRAFT_294767
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     PHYSODRAFT_294767
Protein phosphatases and associated proteins [BR:psoj01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    PHYSODRAFT_294767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 Y_phosphatase3 DSPc CDKN3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 20641151
NCBI-ProteinID: XP_009517041
JGI: Physo3_294767
UniProt: G4YL11
LinkDB All DBs
Position
Unknown
AA seq 341 aa AA seqDB search
MAPRSSACRRVLAVPRALVSQNKRRFQQDGFDLDLGYVHPRVIVMGYPAVGVEFLFRNPR
SEVQQFLDERHGGGYFVFNFCDEPSRCYSPDIFEGRVKSFPIEDHNVPTFQMMFLSRRTE
FCEEAAAWLDANEKHVVALHCKAGKGRAGMMACILLLRMGYAASATDAIDRYNRERVHDR
RGLTVVSQKKWVNYYAGLRAQSSSGPGNSIDEPTFALQKLTLRNTLTAAKLPKLRLRVYT
LGASGSPKALLHQEIGFNNFELDEEIRGCVMIEFYRERVNGCMRRKHFKIWFNTYFLNPD
QDTGRVIFSRSDMDWVARDSKYRRLPAAFEMEMTVTRSDQM
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcgctcgtccgcctgccgccgcgtgctggccgtgccgcgcgccctcgtctcg
cagaacaagcggcgcttccagcaggacggcttcgacctggacctgggctacgtgcacccg
cgcgtcatcgtcatgggttacccagctgtaggggtcgagttcctgttccgtaatccgagg
tcggaggtgcagcagttcctggacgaacgacacggaggcggctactttgtcttcaacttc
tgcgacgagcccagtcgatgttactcgccagatatttttgagggtcgagtcaagagcttc
ccaattgaagaccacaacgtcccaacgttccagatgatgtttctgtctcgtagaaccgag
ttttgtgaagaagcagcggcgtggcttgatgccaacgagaaacatgtcgtggcgctgcac
tgcaaggctggaaagggacgagctggtatgatggcgtgtattctgctcttgcgcatgggc
tacgctgcatccgcgaccgacgcgatagatcggtacaatcgtgagcgcgtacacgaccgg
cgcggtctaaccgtcgtgagccaaaagaagtgggtcaactactatgctggtcttcgtgca
cagtcatcttctggacctggaaactccattgatgagccaaccttcgcacttcagaagctg
actctacggaatacactgaccgcagcgaaattacccaagttacgactgcgagtctataca
ctgggcgctagcgggtctccgaaagcactgctccatcaagagatcggcttcaacaacttc
gagttagacgaggagatccgtggatgcgtcatgatcgagttctaccgtgaacgagtcaac
gggtgtatgcgacgcaagcacttcaagatctggttcaacacctacttcctcaatcctgat
caagatactggaagggtcatcttctctcgctctgacatggactgggtggcccgagacagc
aagtacaggcgacttccagccgcattcgagatggagatgaccgttacccgctcggaccaa
atgtag

DBGET integrated database retrieval system