KEGG   Phytophthora sojae: PHYSODRAFT_312991Help
Entry
PHYSODRAFT_312991 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
psoj  Phytophthora sojae
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psoj01001]
    PHYSODRAFT_312991
Enzymes [BR:psoj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     PHYSODRAFT_312991
Protein kinases [BR:psoj01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   PHYSODRAFT_312991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo FTA2 Kinase-like APH Pkinase_fungal YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 20643549
NCBI-ProteinID: XP_009522955
JGI: Physo3_312991
UniProt: G4Z595
LinkDB All DBs
Position
Unknown
AA seq 371 aa AA seqDB search
MTGIMKKVTEFYKKDECSKYYKLGKTLGTGSFATVKSAISKADNSRWAVKCIDKASLTAE
DEEALRVEVEVLQVVHHVNIVQLKEVFDCHKTFYMVMEEMSGGELFDRIVEKEKYSEKEA
SCVVNKLANALLYCHQKGIVHRDLKPENLLYQSTDENAEIKIADFGLAKLIKGDSLMQTA
CGTPGYVAPEILEGRPYGAEVDLWSLGVIAYILLCGFPPFYDENNAALFQSIKSGVYDYP
SPYWDCVSDSAKDLISRLLVVDPKKRFTAQQVLDHPWVADIHGVSGDVLPHFTHEMKRYN
ARRRFRAGIMAAKTISALHSIQKRVSASDFEPPTSAIAAVGLGALKAASAAPATEAGATP
AAPAPAAPVTQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcatcatgaagaaggtgaccgagttctacaagaaggacgagtgtagcaagtac
tacaagctgggcaagacgctcggaactgggagcttcgccacggtgaagagcgccatcagc
aaggccgacaactcgcggtgggccgtcaaatgcatcgacaaggcgagtctcacggcggag
gacgaggaggcgctgcgggtcgaggtggaagtgctgcaggtggtgcaccacgtcaacatc
gtgcagctcaaggaggtgttcgactgccacaagacgttctacatggtcatggaggagatg
agcggcggcgagctcttcgaccgcatcgtggagaaggagaagtactcggagaaggaggcg
agctgcgtggtcaacaagctggcgaatgcgctgctctactgccaccagaagggcatcgtg
caccgtgacttgaagcccgagaacctgctctaccagtccacggacgagaacgcggagatc
aagatcgccgacttcggtctggccaagctcatcaagggcgactcgctcatgcagacggcg
tgcggcactccgggctacgtggccccggagatcctcgagggccgtccgtacggagctgag
gtggatctctggagtctcggcgtcatcgcctacatcctgttgtgcggcttccctccgttc
tacgacgagaacaacgccgcgctcttccagtcgatcaagtcgggcgtctacgactacccg
agtccgtactgggactgcgtgtccgactcggccaaggacctcatctcgaggctgctcgtc
gtggaccccaagaagcgcttcacggcgcagcaagtgctggaccacccgtgggtggccgac
atccacggcgtcagcggcgacgtgctgccgcacttcacgcacgagatgaagcgctacaac
gcgcgtcgtcgcttccgcgccggcatcatggccgccaagaccatttcggccctgcactcg
atccagaagcgcgtgagtgccagcgactttgagccgccgacgtcggccattgccgcggtt
ggattgggggcgctgaaggccgcgtcggcggcgccagcgacggaagcaggagcaactccc
gctgctccagcccccgcagcgccagtgacgcagtag

DBGET integrated database retrieval system