KEGG   Phytophthora sojae: PHYSODRAFT_477603Help
Entry
PHYSODRAFT_477603 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
psoj  Phytophthora sojae
Pathway
psoj00220  Arginine biosynthesis
psoj00250  Alanine, aspartate and glutamate metabolism
psoj01100  Metabolic pathways
psoj01200  Carbon metabolism
psoj01210  2-Oxocarboxylic acid metabolism
psoj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psoj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHYSODRAFT_477603
   00220 Arginine biosynthesis
    PHYSODRAFT_477603
Enzymes [BR:psoj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PHYSODRAFT_477603
Amino acid related enzymes [BR:psoj01007]
 Aminotransferase (transaminase)
  Class I
   PHYSODRAFT_477603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 20654910
NCBI-ProteinID: XP_009515719
JGI: Physo3_477603
UniProt: G4YHC5
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MLARQAFKQLRSASFLASRGFAVLTADTINPNIVKAEYAVRGAIVLRSNEYEDRLARGDA
SLPFDKVIPCNIGNPLVLKQEPIEFHRQVLALVNVPGLVDRPEIKQLFPEDAIERAKFYI
NNIVGGTGAYGHSKGTNVVREEVARFLQRRDNHPADPEDIYLTDGASPAVQNSLLTLIRD
ENDAILAPIPQYPLYSAAIAINGGSLVGYYLDEEKAWGLDVKELARAVKEARDAGKTVRA
MAVINPGNPTGQCLSVENIEAIIKFCKDENILILADEVYQENVYAEGKKFVSFKKVLRDM
GKAYDDVELISFHSTSKGFTGECGRRGGYMELVNIDDGAKDQFYKLMSVNLCSNVEGQLM
VGLMTNPPQPGDASYKRYIEQRDGTLEALKRRAVKLVKACNELEGVTCNETEGAMYTFPK
ITIPAKAVEAAKAAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRSTILPPEEAV
DEVIEKTVKFHANFMDKYR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcgccaggccttcaagcagctgcgcagcgcgtccttcctggccagccgcggc
ttcgccgtgctcacggccgacacgatcaaccccaacatcgtcaaggccgagtacgccgtg
cgcggcgcgatcgtgctgcgctccaacgagtacgaggaccgtctcgcccggggcgacgcg
tcgctgcccttcgacaaggtcatcccgtgcaacatcggcaacccgctggtgctcaagcag
gagcccatcgagttccaccgccaggtgctggcgctcgtcaacgtgcccggcctcgtggac
cggccggagatcaagcagctcttccccgaggatgccattgagcgtgccaagttctacatc
aacaacatcgtgggcggcactggcgcctatggccacagcaagggcacgaacgtcgtccgt
gaggaggtcgcgcgcttcctgcagcgtcgcgacaaccacccggccgacccggaggacatc
tacctcacagacggcgccagtccggccgtgcagaactcgctgctgacgctgatccgtgac
gaaaacgacgcgatcctggcccccatcccgcagtacccgctgtactcggcggccatcgcc
atcaacggcggctccctggtgggctactacctggatgaggagaaggcgtggggtctggac
gtgaaggagctggcgcgtgctgtgaaggaggctcgcgacgcgggcaagacggtgcgggcc
atggctgtgatcaaccctggcaaccccacgggtcagtgcctgtcggtggagaacatcgag
gcgatcatcaagttctgcaaggacgagaacatcctgatcctggccgacgaggtgtaccag
gagaacgtgtacgccgagggcaagaagttcgtgtcgttcaagaaggtgctgcgcgacatg
ggcaaggcgtacgacgacgtggagctgatctcgttccactcgacgtccaagggcttcacg
ggcgagtgcggtcgccgcggtggctacatggagctggtcaacattgacgacggcgccaag
gaccagttctacaagctcatgtcggtgaatctgtgctcgaacgtggagggccagctgatg
gtgggactgatgaccaacccgccgcagcctggcgatgcctcttacaagcgctacatcgag
cagcgtgacggcacgctcgaggcgctcaagcgtcgcgctgtgaagctggtcaaggcttgc
aacgagctggagggcgtcacgtgcaacgagactgagggcgcgatgtacacgtttccgaag
atcacgattccggccaaggccgttgaggccgcgaaggctgcgggcatggcgcccgatgcc
ttctactgcatgcagatgctggacgagacgggaattgtggtggtgcctggctcgggtttc
ggccagaaggagggcacgtggcacttccgctcgacgatcctccctcccgaggaagctgtg
gacgaggtgatcgagaagacggtcaagttccacgccaacttcatggacaagtaccggtag

DBGET integrated database retrieval system