KEGG   Phytophthora sojae: PHYSODRAFT_482876Help
Entry
PHYSODRAFT_482876 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
psoj  Phytophthora sojae
Pathway
psoj00970  Aminoacyl-tRNA biosynthesis
psoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PHYSODRAFT_482876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psoj03029]
    PHYSODRAFT_482876
Enzymes [BR:psoj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PHYSODRAFT_482876
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PHYSODRAFT_482876
Mitochondrial biogenesis [BR:psoj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHYSODRAFT_482876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 20655546
NCBI-ProteinID: XP_009521164
JGI: Physo3_482876
UniProt: G4Z0M7
LinkDB All DBs
Position
Unknown
AA seq 529 aa AA seqDB search
MAQVAANGARQPLLQLLRGPSGKLWEVCIGLEVHAQVQTRSKLMSGAAAATLSSARPNRH
VSFFDAALPGTLPVINRECVHQAIRTGLAVDATVHPRSLFERKHYFYCDLPLGYQLTQQR
APVASGGALHFELPASADVIPRSVRITRIQIEQDSGKSNHDLEEHSTVVDLNRAGTALLE
IVMEPDLRSPLEAGQVMRQLQHLLRHLDVCDGNMEEGSMRCDLNVSVRPTNLGEEADVEA
LHTALTSSTAPPFGERVEVKNMNSIRNMMRAAEYEARRQIALIEEEGGEVHRETRSFDAV
TGETKRMRSKEGAKDYRFFPEPDLPRLVVPEQLIQEISESLPELPDALKDRLCAQYDLTP
YESSVLVNEPGAAQYFETVALEKSRPSKMVVNWVLNDLFGHLKATNGDIAGSPVQATELG
GLIDLIQDGTISGKIAKDVLELMFYENEAKKTPLQIVEEKGWKQIQDPEEIRALCQAVLD
DPKNLDAYWNGKTQLFGFFIGQVMKRCGGRVHPELANTIMQEVLEEHKQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtcgcggcgaatggcgcgcgtcagccgctgctgcagctgctgcgcggcccg
agcggcaagctgtgggaggtctgcatcggtctggaggtgcacgcgcaggtgcagacgcgc
tccaagctcatgagcggcgccgcggcggccacgctctcgtccgcgcggcccaaccgccac
gtcagcttcttcgacgcggcgctgccgggcacgctgccggtcatcaaccgcgagtgcgtg
caccaggccatccgcacggggctggcggtggacgccacggtgcacccgcgctcgttgttc
gagcgcaagcactacttctactgcgatctgccgctcggctaccagctgacgcagcagcgc
gcgccggtggcgtccggcggcgcgctgcacttcgagctgccggcgtccgcggatgtgatc
ccgaggagtgtgcggatcactcgtatccagattgagcaggattcaggcaagagcaaccac
gacttggaggagcacagcaccgtggtggaccttaaccgtgcgggtacggcgctgctggag
atcgtgatggagccggatctccgcagtcctctagaagctggtcaggtgatgcgtcaactg
cagcatttgctgcgccacttggacgtgtgtgatggaaacatggaggaaggctcgatgcga
tgcgacttgaacgtgagcgtccgcccgacgaatcttggagaagaggccgatgttgaagcg
ctacataccgcactcacttccagcactgcgccgccgttcggtgagagagtcgaggttaag
aacatgaacagtattcgcaacatgatgcgtgccgcggagtatgaagccaggagacagatc
gcgctgatcgaggaggaaggaggagaggtgcaccgcgagacgcgttcgttcgatgccgtc
accggagagaccaaacgcatgcgatcgaaggagggagccaaggattaccgtttcttcccg
gagcctgacctgccccggcttgtcgtcccggaacagcttatccaggaaattagtgaaagt
ctgcctgagcttccagatgcattgaaggaccgcctgtgtgctcagtacgacctcacgccg
tacgagagctccgttttggtgaatgagcctggtgcagcgcagtatttcgaaactgttgcg
ttggagaaatcgcggccgtccaagatggttgtcaactgggtgctgaacgatttgtttgga
cacctgaaggcaacgaacggcgacattgccggaagccctgttcaggccacggagctggga
ggtctcattgatttgatccaggacggcacgatctccggcaaaattgcgaaggacgtgctg
gagctcatgttctacgaaaacgaagcgaagaagacgcccctgcagattgttgaggagaag
ggctggaagcagattcaggacccggaggagatccgcgcactctgccaagccgttcttgat
gatccgaagaacctggacgcgtactggaacggcaagactcagctctttgggttcttcatc
ggtcaggtcatgaagcgctgcggtggtcgcgttcacccggagcttgcgaacaccattatg
caggaggttctggaggagcacaaacaatag

DBGET integrated database retrieval system