KEGG   Phytophthora sojae: PHYSODRAFT_538205Help
Entry
PHYSODRAFT_538205 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
psoj  Phytophthora sojae
Pathway
psoj01040  Biosynthesis of unsaturated fatty acids
psoj01100  Metabolic pathways
psoj01212  Fatty acid metabolism
psoj04146  Peroxisome
Module
psoj_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:psoj00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PHYSODRAFT_538205
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PHYSODRAFT_538205
Enzymes [BR:psoj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PHYSODRAFT_538205
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     PHYSODRAFT_538205
    4.2.1.119  enoyl-CoA hydratase 2
     PHYSODRAFT_538205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR 3HCDH_N Sacchrp_dh_NADP DUF4158
Motif
Other DBs
NCBI-GeneID: 20662343
NCBI-ProteinID: XP_009517336
JGI: Physo3_538205
UniProt: G4YNA8
LinkDB All DBs
Position
Unknown
AA seq 289 aa AA seqDB search
MLRFDGKVAIVTGSGAGIGRCYALLFAERGAKVVVNDFSKEAADSVVNEIKAKGGVAVAN
YNSVTDGEKVVATAIENFGRVDILVNNAGILRDVTFAKMTKAQWNQVLDVHLQGTFAVTH
AAWPHMRKQKYGRVILITSVNGLYGQFGQTNYSSVKAAMTGFGKSLAKEGARSNIKVNIV
APGAGSKMTETIMPADLVAAWKPEYVAPTIAFLCHESVPCSGKIFESGGGFVAQVKYVRS
PGVFLDLEKEITPEAVQAKFAQITDFTNATDPDDDETSPQIKQILSAKL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcttcgacggcaaggtcgctatcgtcaccggctccggcgctggaatcggccgc
tgctacgcgctgctgttcgccgagcgcggcgccaaagttgtggtgaacgacttcagcaag
gaggcggcggactcggtggtcaacgagatcaaggccaagggtggcgtcgcggtcgccaac
tacaactcggtgacggacggcgagaaagtggtggccactgccatcgagaacttcggccgc
gtggacatcctggtcaacaacgccggcatcctgcgcgacgtgaccttcgccaagatgacc
aaggcccagtggaaccaggtgctcgacgtgcacctccaaggaacgttcgcggtgacccac
gccgcgtggccccacatgcgcaagcagaagtacggccgcgtgatcctcatcacgtcggtg
aacggtctgtacggccagttcggccagaccaattacagctccgtgaaggccgctatgacc
ggcttcggcaagtcgctggccaaggagggcgctcgctcgaacatcaaggtgaacatcgtg
gcccccggcgccggctccaagatgacggagacgatcatgcccgcggacctcgtggcggcg
tggaagcccgagtacgtggcgcccacgatcgccttcctgtgccacgagtccgtgccctgc
tcgggcaagatcttcgagagtggcggcggcttcgtcgcgcaggtcaagtacgtgcgcagc
cccggcgtgttcctggacctggagaaggagatcacgcccgaggccgtgcaggccaagttc
gcccagatcacggacttcaccaacgccactgacccagatgacgacgagacctcgccgcag
atcaagcagatcctgtccgccaagctgtaa

DBGET integrated database retrieval system