KEGG   Papaver somniferum (opium poppy): 113284373Help
Entry
113284373         CDS       T05758                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00010  Glycolysis / Gluconeogenesis
psom00020  Citrate cycle (TCA cycle)
psom00620  Pyruvate metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Module
psom_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113284373
   00020 Citrate cycle (TCA cycle)
    113284373
   00620 Pyruvate metabolism
    113284373
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     113284373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 113284373
NCBI-ProteinID: XP_026389604
LinkDB All DBs
Position
1
AA seq 492 aa AA seqDB search
MASLLLSRVPTTTTNTISFSSSLNNNLPFPSRRLSLTSPFPSKPNRKIPTIQAKIREIFM
PALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVAEGEVA
PVGAAIGLLAETEDDVAEAKSRASSKSTSTSPPPSPPSDIQPTSSPSPPPVKPSSSSSPP
TVSEGPKKTVLTPEAKKLAKKHKVNVESIVGTGPFGRITPADIESAAGVSPSSKSVSQIS
NVAPAAPISSTSPPPPKASPSAPSLPEIPGSTIVPFTTMQSAVSKNMVESLSVPTFRVGY
PMKTDALDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNSSCKDGKSFTYNSSINIAVA
VAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVD
RFDAILPPGQGAIMAVGASKPTVVTDEDGYFSVKNQILVNVTADHRVIYGADLASFLKTF
AKIIENPESLTL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttactactatctagggttcctacaacaacgacaaacacaatctcattttct
tcatctctgaataacaatttaccgtttccatctcgtcgattatcattaacaagcccattt
ccaagtaaacccaatcgaaagatcccaacaattcaagcgaaaattagggagatcttcatg
ccagctttgagttcaacaatgactgaaggtaaaattgtatcttggatcaaatccgaagga
gatgtattatcaaaaggtgaaagtgttgttgttgtcgaatctgataaagctgatatggat
gtggaaactttttatgatggaattcttgctgctattgttgttgccgaaggtgaagttgct
cctgttggcgctgctattggtttacttgctgaaactgaagatgatgttgctgaagccaaa
tctagagcttcatccaaatcaacttctacttctcctcctccttcccctccctctgatatt
caaccaacttcttctccttctcctccaccagtaaaacctagttcttcttcttccccacct
actgtttcagaaggtccaaagaagactgttttgactccagaggcaaagaaacttgctaag
aaacacaaggttaatgtggaatcaattgttggaactggaccatttggtagaattacacct
gcagatattgaatcagctgctggcgtttcaccttcttccaagagtgttagtcaaattagc
aatgtagctccagctgctcccatttcttccacttctcctcctcctcctaaagcttcacca
tctgctccttctcttcctgaaattccaggttctacaattgttccttttactacaatgcag
tctgcggtttccaaaaatatggtggaaagtctttcagtgcctactttccgtgttggttat
cctatgaaaactgatgccttagatgccctttatgaaaaggtgaagcctaagggagtaact
atgactgcattgttagcgaaagccgccgctatggctcttgctcaacatcctgttgtaaat
tctagttgcaaagatgggaagagttttacttataactccagtataaatattgcagtggca
gttgcaattaatggtgggctcataacacctgtgctccaggatgctgataagttagatctt
tatttgttatctcaaaaatggaaagaactagtagagaaagctcgttctaaacaactccag
ccccacgaatacaattcagggacattcacactatccaatttgggcatgtttggagtggac
agattcgatgccatacttcctccaggccaaggggctatcatggctgtaggggcttccaag
cctacagttgtgacagatgaagatggatatttcagtgtgaagaatcaaatcctggtcaat
gtaacagctgatcaccgggttatatacggtgctgacttagcatccttcctgaagacattt
gcaaagattatagagaacccagaaagcctcacattgtag

DBGET integrated database retrieval system