KEGG   Papaver somniferum (opium poppy): 113287071Help
Entry
113287071         CDS       T05758                                 

Definition
(RefSeq) aminoacylase-1-like
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00220  Arginine biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01210  2-Oxocarboxylic acid metabolism
psom01230  Biosynthesis of amino acids
Module
psom_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    113287071
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psom01002]
    113287071
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113287071
Enzymes [BR:psom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     113287071
Peptidases and inhibitors [BR:psom01002]
 Metallo peptidases
  Family M20
   113287071
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113287071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Motif
Other DBs
NCBI-GeneID: 113287071
NCBI-ProteinID: XP_026391516
LinkDB All DBs
Position
6
AA seq 437 aa AA seqDB search
MKGTKFLTLLLIILSLYRQSAAEEDTSVSRFQNYLRFKTAHPNPDYSKPVSYLTSQAQSI
GLKTTIFEFSPSKPLLIITWVGSNPSLPSILLNSHLDSVPAEPSKWIYPPFAATKTEDGK
IYARGAQDDKCIGMQYLEAIRELKVVQGYSPVRTVHISYVPDEEIGGANGAAKFAGSDEF
KSLNIGFMLDEGQASTSEKFRVFYADRAIWRLIIKASGMPGHGSRMFDNSAMENLMKSVE
IMTRYREGQFDLVKAGLAMNSEVISVNPVYMKAGTPSPTGYQMNMQPSEAEAGFDIRFPP
TADLELFRKRIVDEWAPHHRNMTYELTEHEPVKDHLGSPIMTATDDRNPWWGVFSKAIVS
AGGTLSKPEILASTTDARFIRALGIPTFGFSPMTNTPILLHEHNEYLEETVYIRGIKIYE
SVIRALSSFEGGNHEST
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaccaaatttctcactctgctgctcatcatcttatctctgtacagacaatca
gcagcagaagaagacacctcagtaagcagatttcagaactatctaagattcaaaacagct
catccaaacccagattattcaaaaccagtttcatacttaacatctcaagctcaatcaatt
ggtcttaaaactacaatctttgaattttccccatcaaaaccacttcttatcataacttgg
gttggttcaaatccatctttaccatcaatcttactaaattcacatcttgatagtgttcct
gctgaaccatccaaatggatatacccaccttttgcagcaactaagacagaagatggtaaa
atctatgcaagaggtgctcaagatgataaatgtattggtatgcaatatcttgaagcaatt
cgggagctgaaagttgttcaaggttatagtccagtgaggactgttcacatatcttatgtt
cctgatgaggagattggtggggctaatggagctgcaaaatttgctggttcggatgagttt
aagagtttgaatattggatttatgttggatgaaggtcaagcatctactagtgagaaattt
agagtcttttatgctgatagagcaatttggaggttgataattaaggcatcaggtatgcct
ggacatgggtctaggatgtttgataatagtgccatggagaatttgatgaagagtgttgaa
attatgactagatatagagaagggcaatttgatttggttaaagctggattggcaatgaat
tcagaagttatatcggtgaatcctgtgtatatgaaagccggtactccttcacctacgggt
tatcaaatgaatatgcaaccttcagaagctgaagcaggatttgatattcggtttccacct
acagcagatctagagctattcagaaagagaatcgttgatgaatgggcaccacatcataga
aacatgacatatgagttaactgagcatgagcccgtgaaagaccacttggggagtcctata
atgacagcaaccgatgatcgcaatccgtggtggggtgttttcagtaaggccatagtttct
gctggaggaacactctctaagcctgaaattctggcctctacaactgatgcacgtttcata
agagcgctgggaattcctacttttgggttttccccaatgacaaatactccaatcctgctt
cacgagcacaatgagtacctagaggaaaccgtctacataagaggaataaagatatatgaa
tctgtgatcagggcattgagttcttttgaaggaggaaaccatgaatcaacctag

DBGET integrated database retrieval system