KEGG   Papaver somniferum (opium poppy): 113289232Help
Entry
113289232         CDS       T05758                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00020  Citrate cycle (TCA cycle)
psom00190  Oxidative phosphorylation
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113289232
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113289232
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113289232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 113289232
NCBI-ProteinID: XP_026394218
LinkDB All DBs
Position
6
AA seq 632 aa AA seqDB search
MWRCVSRGLGFASSSSKRSITNEALKPLVSRFLSTESTGGYTIVDHTYDAVVVGAGGAGL
RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLG
DQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAAD
RTGHALLHTLYGQAMKHNTQFFVEYFALDLIMDSSGACQGIIALNMEDGTLHRFRAASTI
LATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRG
EGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGPLKDHIYLHLNHLPP
EVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTVKGDNPDSVI
PGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGAPQKPLESDAGQKT
IEWLDKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLAEGCELIDQTWDSFKNVGLK
DRSLIWNSDLIETIELENLLINACVTMHSAEARKESRGAHAREDFSTRDDVTWMKHTVGY
WENEKVRLDYRPVHMNTLDDEMDTIPPKARVY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtttcaagaggattaggttttgcatcttcttcatcaaagagatctatc
acaaatgaagctcttaaacccttagtttcaagattcctctcaactgaatcaacaggagga
tatacgattgttgatcatacgtacgatgcggttgtggttggagctggtggtgcaggactt
agagcagccattgggctttccgagcatggatttaatactgcttgtattaccaagcttttc
cctacacgttctcacacagtcgctgcacagggtggtataaatgcagcgctagggaatatg
tctgaagatgattggaggtggcacatgtatgatacagttaaaggaagtgattggttaggt
gatcaggatgctattcagtacatgtgcagggaggcaccaaaagcagtcatagagctagaa
aattatggattaccattttctcgaactgaagaaggaaaaatttatcagcgcgcttttggt
ggtcaaagtctggacttcgggaaaggtggtcaggcctaccgttgtgcatgtgccgctgat
cggactggccatgctttgctgcacactctgtacggtcaagcaatgaagcacaacacacag
ttctttgtggaatactttgcgttggatcttataatggacagtagtggtgcttgccaagga
ataattgcactaaatatggaggatgggactctgcatcggttccgagctgcttctaccatt
ttggccaccgggggttatgggagagcatacttctcagcaacttcagctcatacatgtact
ggagatggaaatgccatggttgcacgtgctgggctaccacttcaggatcttgagtttgtg
cagttccaccccacgggtatatatggtgctggctgcctcattactgaaggatctcgaggt
gaaggtggtatccttagaaatagtgaaggtgaacgctttatggagcgatatgccccaact
gctaaggatcttgcatcaagagatgttgtttcaagatctatgaccatggaaattcgggac
ggccgtggtgtaggaccgctgaaggatcacatctatctccacttgaaccacttacccccc
gaagttctgaaggaaagacttccaggtatctcagagacagctgccatttttgcgggtgtt
gacgtcaccaaggagcccatcccagtgttacctactgttcactataatatgggaggtata
cctacaaattaccatggagaggttgttaccgtgaaaggggacaatccagattcagtaatt
cctggactaatggctgctggggaggcggcatgtgcatctgtccatggggctaatcgactc
ggtgcaaactctttactagacattgttgtttttggtcgagcttgtgcaaatagagttgcc
gagatccaaaagccaggtgcgccacaaaaaccattggagagtgatgctggacagaaaacc
attgaatggctggataaactcaggaactcaaatggttcactgccgacttcaaagatccgt
ctgaatatgcaaagagtgatgcaaaataatgctgctgttttccgtacccaggaaacttta
gcagaaggttgcgagttaattgaccaaacatgggacagctttaaaaatgttgggttgaag
gatcgaagtctgatatggaattctgatttgattgaaacgattgaattagaaaaccttctc
ataaatgcatgtgttaccatgcactctgctgaagctagaaaggagagcagaggagcacat
gcccgtgaagatttcagtacaagggatgatgtgacctggatgaagcacactgtggggtat
tgggagaatgagaaggtcaggcttgattacaggccagttcatatgaacacattagatgat
gaaatggatacaatccctccaaaagctcgtgtttattag

DBGET integrated database retrieval system