KEGG   Papaver somniferum (opium poppy): 113302348Help
Entry
113302348         CDS       T05758                                 

Definition
(RefSeq) sorbitol dehydrogenase-like isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00040  Pentose and glucuronate interconversions
psom00051  Fructose and mannose metabolism
psom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113302348
   00051 Fructose and mannose metabolism
    113302348
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     113302348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 UDPG_MGDP_dh_N NCD3G Pyr_redox_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 113302348
NCBI-ProteinID: XP_026407045
LinkDB All DBs
Position
8
AA seq 364 aa AA seqDB search
MGKGGMSHGGGGGDGEENMAAWLLGVDNLQIQPFKLPPLGPHDVRVRMKAVGICGSDVHY
LKTMRCADFIVKEPMVIGHECAGIIEEVGKEVKSLIPGDRVALEPGISCWRCNLCKDGRY
NLCPDMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIG
PETNVLIMGAGPIGLVTLLAARAFGAPKIVIVDVDDHRLSVAKKLGADDIVKVSTNIQRV
DNEVVQIQKTMGVGVDVTFDCAGFEKTVRTALNATQPGGKVCLVGMGHNEMTVPLTPAAA
REVDVVGIFRYKNTWPLCLEFIQSGKIDVKPLITHRFGFSQEEVVEAFETSARGSTAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggagggatgtctcatggtggtggtggtggtgatggtgaagaaaacatggca
gcatggcttcttggtgtggataatcttcaaatccaaccattcaagcttcctcctcttggt
ccccatgatgttagggttagaatgaaagctgtgggtatctgtggaagtgatgttcactac
ctcaagaccatgagatgtgctgactttattgtgaaagaaccaatggtgattggacatgag
tgtgctgggatcatagaagaagttggaaaggaagtgaaatctctaatacccggtgatcga
gtagcgctagaacctggaattagctgctggagatgtaatctttgtaaagatggtcgatat
aatctatgtcccgatatgaagtttttcgcaacaccaccagttcatggctctcttgcaaat
caggtggtgcatcctgcggatttatgctttaagctgcctgacaatgtgagcttagaggaa
ggagcaatgtgtgagcctctgagtgttggtgtccatgcttgtcgtcgtgcaaacattggt
ccagaaacaaacgtgttgataatgggagcaggccctataggacttgtcactcttctggca
gctcgagcttttggagccccaaaaattgttattgtggatgtggatgatcatcgtttatct
gttgcaaagaaactcggtgcagatgacattgtcaaagtttcaacaaatattcagcgtgtg
gataacgaagtggttcagattcaaaaaacaatgggggttggagtggatgtgaccttcgat
tgtgcaggctttgaaaaaactgtaaggacggccctaaatgctacacaaccaggtggtaaa
gtttgtcttgtgggaatgggccataacgagatgactgtcccacttactccagctgctgca
agagaagttgacgtggtaggcattttccggtataagaatacgtggccactttgtctggag
tttatacaaagtggaaagatcgacgtgaagccgcttataacacacagatttgggttttct
caggaagaagttgtggaagcatttgaaactagcgctcgtggtagtactgctattaaggtc
atgtttaacctttaa

DBGET integrated database retrieval system