KEGG   Papaver somniferum (opium poppy): 113303166Help
Entry
113303166         CDS       T05758                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00250  Alanine, aspartate and glutamate metabolism
psom00410  beta-Alanine metabolism
psom00430  Taurine and hypotaurine metabolism
psom00650  Butanoate metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    113303166
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    113303166
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113303166
   00430 Taurine and hypotaurine metabolism
    113303166
Enzymes [BR:psom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     113303166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 113303166
NCBI-ProteinID: XP_026407968
LinkDB All DBs
Position
8
AA seq 499 aa AA seqDB search
MVLSKAESHSDASVHSTFASRYVRTILPRFKMGEDSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLEEAEAAVG
VGTVGSSEAIMLAGLAFKRRWQNKMRAEGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRTKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGYEGYRNIMENCSENALVLKEGLEK
TGRFNIISKDIGVPLVAFSLKDNTQHNEFEISDSLRRFGWIVPAYTMPPNAQHVTVLRVV
IREDFSRTLAERLVSDIEKVMHELDALTARVTSKILVTKEKKENDVNVTVVKKTELETQR
EITDAWKKFVKARKTNGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggttctatccaaagcagaatctcattctgatgcttcggttcactcaacttttgcatcc
cgctatgttcgtactatccttcccagatttaagatgggggaggattccatccctaaagaa
gcagcatatcagatcattaacgatgagctgatgttagatggtaatcctagattgaatctg
gcttccttcgtcaccacttggatggaacctgaatgtgataaactcatcatggattctatt
aacaagaattacgttgacatggatgaataccctgttactactgaattgcagaaccgatgt
gtgaatatgattgcacgtctctttaacgccccacttgaggaagcagaggctgctgtagga
gttggtacggttggatcatctgaggctatcatgcttgctggattagcatttaaacgtagg
tggcaaaacaagatgagggctgagggtaagccttgcgacaaacctaacattgtcactggg
gccaacgttcaggtttgttgggagaaatttgcaaggtattttgaggttgaactcaaagaa
gtgaaactgagtgagggatattacgtgatggatccagaaaaagctgttgaaatggtggac
gaaaataccatatgtgttgctgctattcttggttcaactctgaatggagaatttgaagac
gttaagctcttgaacgatctcttggtcgagaagaataaggagactggatgggacacccca
atccatgtagacgctgcaagtggtggatttattgcaccgttcatctacccagaattggaa
tgggattttcgattgccattggtgaagagtataaatgttagtggacacaaatacggtctt
gtttatgccgggataggttgggttatctggaggaccaaagaagacttgccagaagaactc
atttttcatatcaactacttgggagctgatcaacctactttcactctcaatttctccaaa
ggatccagccaaattattgctcagtactaccaactgatccgtctgggttatgagggctat
cggaacattatggagaactgcagcgagaatgcgctagttctcaaagaaggacttgagaaa
actggccgcttcaacataatatccaaagacatcggtgttcccttggtagctttctctctc
aaggacaatactcagcataacgagtttgaaatatctgacagcttaagacggtttggatgg
attgttccagcttacaccatgccacctaatgcgcagcacgtaacggttctacgtgttgtt
atacgtgaagatttttctcgtacccttgctgaacgtttagtgagtgacatcgaaaaggta
atgcatgagcttgatgcactcacagctagagttacttcaaaaatattagttaccaaggag
aagaaagaaaacgatgtcaatgttactgtagtgaagaagactgaactggaaactcagaga
gaaattaccgatgcttggaagaagttcgtcaaggccaggaagactaatggtgtctgctag

DBGET integrated database retrieval system