KEGG   Papaver somniferum (opium poppy): 113303805Help
Entry
113303805         CDS       T05758                                 

Definition
(RefSeq) nitronate monooxygenase-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113303805
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     113303805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NMO Sod_Cu FMN_dh IMPDH
Motif
Other DBs
NCBI-GeneID: 113303805
NCBI-ProteinID: XP_026408667
LinkDB All DBs
Position
8
AA seq 492 aa AA seqDB search
MGFTGASALGWDNGIVLAPMGADISGSKLVAAVANAGGIGLLASPVNMYEMTLKLIKDTK
KLTTKPFGAGILLGFEQTNTTVKAIFEEKLACMQVYWGDYTKEMVDEAHKNGVKVLHQLG
SVADAEKAIAAGVDCIIAQGVEAGGHVIGNVSVIALVPRIVDLVGDRNISVVAAGSIADP
RGFVAALALGAKGVCMGTRFIATKESYANDYYKQQLLHYTEADTDYTDLYSRATWTAPTR
VLNTPFHQKWKPVPQDVSNNEEQPIVGYSIIHGGETILRRFAGQVANQTTAGELENMVMY
GGQGVGLVTQILPAGDIIKSFIEGAQKIIKELGGRSQVKPIKAVVLLKSTEGVTGTIYFT
QEGDGPTNVTGSISGLKPGLHGFHIHALGDTTNGCMSTGPHFNPAGKDHGAPEDETRHAG
DLGNLIVGKDGKVEVKIVDKQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGA
RIACGIIGLQAN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcactggcgctagcgctctaggatgggacaatggcatcgtattggcaccaatg
ggagccgacatatctggatcaaaacttgttgcagctgtggccaatgccggaggcattggt
ttattagctagcccagttaatatgtatgaaatgactctgaaattgatcaaggatactaag
aagctcacaactaagccttttggagctggcattctgttgggattcgagcaaaccaatacc
accgtcaaggccatttttgaggaaaagcttgcatgcatgcaagtttattggggagactat
accaaagaaatggtggatgaagcacataaaaatggagtcaaggtcttgcaccagttaggt
tcagttgctgacgcagaaaaagcaattgctgcaggtgttgattgtatcattgcacaaggt
gtggaagctggaggacatgttattgggaatgttagtgtaattgccttggttcctagaatt
gtggatttagtcggcgacaggaatatttcagttgttgctgctggatccatcgctgaccct
cgtggatttgtcgctgccctagcgcttggagctaaaggtgtttgtatgggaacaaggttc
atagctacaaaggaatcgtatgcaaatgactactacaagcaacaattgcttcattacacc
gaagccgatacggactacactgatctatatagccgtgccacttggaccgcaccgactcgt
gttcttaatacacctttccatcaaaaatggaaaccagtaccgcaagacgtctcgaacaat
gaagaacaaccaatcgttggttactctataattcatggaggggaaacgattctacgtcgg
tttgccggacaagtagcaaaccagaccaccgccggggaacttgaaaacatggtcatgtat
ggaggacagggtgtcggacttgtgactcaaatccttcctgctggtgacatcattaagagt
ttcattgagggtgctcaaaagatcattaaggagcttggtggcagatcacaggtaaaaccg
attaaagccgtcgtccttcttaaaagcactgaaggtgtcaccggcaccatctactttact
caagaaggggatgggccaaccaatgtaactggaagtatctctggtcttaaacctggactt
cacggtttccatatacatgcccttggcgacacaacaaatggttgtatgtcaactggacct
cattttaatcctgctggcaaagaccatggtgctcctgaagatgaaacccgtcatgctggt
gatcttggaaatctcatcgttgggaaagatgggaaagttgaggtgaagattgtcgacaag
cagattccacttactggaccaaattccattatcggaagggctgttgttgtacatgctgac
cctgatgatcttggaaagggtgggcatgaactgagcaagaccactggtaatgctggtgca
agaatcgcttgtggtattatcggtcttcaggctaattga

DBGET integrated database retrieval system