KEGG   Papaver somniferum (opium poppy): 113310947Help
Entry
113310947         CDS       T05758                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:psom00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113310947
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     113310947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 113310947
NCBI-ProteinID: XP_026415552
LinkDB All DBs
Position
9
AA seq 205 aa AA seqDB search
MATQTILAAATATPSKPLLSSSFSNPIPLSFSSISYPTSKRSSSRSLTVVSALKKAVAVL
KGTTTVEGVVTLTQEDDGPTTVNVKISGLTPGLHGFHLHEFGDTTNGCISTGPHFNPNGL
THGAPCDEVRHAGDLGNITANADGVAEATIVDSQIPLSGPNAVVGRALVVHELEDDLGKG
GHELSLSTGNAGGRLACGVVGLTPV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcagacaatcttagctgctgcaacagcaacaccatctaaaccacttctatct
tcatcattctcaaacccaattcctctttcattctcttctatcagttacccaacatcaaaa
cgttcatcatcaaggtctcttactgttgtttcagcattgaaaaaagctgttgctgtactt
aaaggaactactactgttgaaggagttgttactttaactcaagaagatgatggtccaact
actgtgaatgttaaaatttctgggctaacacctggacttcatggattccatcttcatgag
tttggtgatactactaatggatgtatctcaacaggtccacatttcaatccgaatggattg
acacatggtgctccttgtgatgaagtccgccatgcgggtgacctggggaacataactgct
aatgctgatggtgtggcggaggcaacaatagtggatagtcagattccattaagtggacca
aatgcagtagttggaagagctttggtcgttcacgagcttgaggatgaccttggaaaggga
ggccatgagctcagccttagcacaggaaatgcaggtggaagattagcgtgcggtgttgtt
ggtttgactccagtttaa

DBGET integrated database retrieval system