KEGG   Papaver somniferum (opium poppy): 113313363Help
Entry
113313363         CDS       T05758                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03030  DNA replication
psom03410  Base excision repair
psom03420  Nucleotide excision repair
psom03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    113313363
   03410 Base excision repair
    113313363
   03420 Nucleotide excision repair
    113313363
   03430 Mismatch repair
    113313363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:psom03032]
    113313363
   03400 DNA repair and recombination proteins [BR:psom03400]
    113313363
Enzymes [BR:psom01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     113313363
    6.5.1.6  DNA ligase (ATP or NAD+)
     113313363
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     113313363
DNA replication proteins [BR:psom03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    113313363
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     113313363
DNA repair and recombination proteins [BR:psom03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     113313363
   NER (nucleotide excision repair)
    Other NER factors
     113313363
   MMR (mismatch excision repair)
    Other MMR factors
     113313363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase TP2
Motif
Other DBs
NCBI-GeneID: 113313363
NCBI-ProteinID: XP_026417910
LinkDB All DBs
Position
9
AA seq 771 aa AA seqDB search
MLTLRSCSYFGRKPLISTSFLPRFLFSKNNPLISISPFSSKPNRNPKIKYLEMSDPPAPK
NAFAMLMGNRPNAKKKPQSPSPSPSKKDAKTLTEDALKVEAVTEDGPLAKKPKTLEGVKE
ESKEVKKEDKSVNLGEKIALLKKKGLDFKPKSAAFWKAGESIPFVFLARAFDLISNESSR
IVITDILGNVFRTVIATTPGDLVSFVYLSACKIYPAHDGIELGIGDAAIIKSLSEAYGKS
ETQIKKELKKEGDLGLVAKASRSSQSTMFKPAPLTVAKVLDTFRILAKVSGKDSQERKRN
HIKALLVAASDCEPLYIIRLLQSKLRIGLAEQTVLVALAQAAAYSERPSDPPIEEAVKVI
KQVYSVHPKYDTIVSALLSDGVLKLPDTCTFVPGVPIGPMLAKPTKGVSEILDKFQNRDF
TCEYKYDGERAQIHYLEDGSVEIYSRNAERNTGKFPDVIQSVQRFKKPSVSSFVLDCEVV
AFDRKNSKILSFQKLSNRARKDVSIDDITVQVCIFAFDILYLNGEQLLQEQLNVRRKHLY
DSFVEVPGEFKFATEVTSNDLEAIQTFLDTAIVDSCEGLIVKTLSTEATYEPAKRSNNWL
KLKKDYMDNIGDSLDLVPIGAYHGRGKRTGGYGGFLLACYDDEKEEFQCICKIGTGFSEK
MLEERSSSLESQVIPQPKSYYRFTDATNPDVWFEPTEVWEVKAADLSISPVYLAAAGAVD
AVKGISLRFPRLLRVREDKKPEEATTSDQVADMYRAQKINHGNNQDEEDDN
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgctgactctgcgttcatgttcttatttcggtagaaaacccctaatttcgacatcattc
ctgccccgatttctcttctccaaaaacaacccattgatatcaatctcccctttctcttca
aaacctaatcgtaaccctaaaatcaaatatctcgaaatgtctgatccaccagcaccaaaa
aatgctttcgctatgctcatgggtaatcgacctaatgcaaagaaaaaaccccaatctcct
tctccatctccttccaagaaggacgctaaaaccctaacagaagatgcccttaaagttgaa
gctgtaaccgaagatggtcctctggctaagaaacctaaaaccctagaaggggtaaaagaa
gagtcaaaggaggtcaagaaggaagacaaatcagttaatctgggtgaaaagattgctttg
ttgaaaaagaaaggattagattttaagccaaaatcggctgcgttttggaaagccggggaa
tcgattccgtttgtgtttcttgctagggcatttgatctgatatctaacgagtcatcaaga
attgtgattacagatattcttggtaatgtttttagaactgtaattgctactacacctgga
gatttggtttcttttgtttatctatctgcatgtaaaatttatcctgcacatgatgggatt
gagcttggaattggagatgctgctattattaagtcacttagtgaagcttatggaaagagt
gagactcaaattaaaaaagagctcaagaaagagggagacttgggtttggtagcaaaagca
agccgttcttctcaatctacgatgttcaagcctgctccattaactgttgcgaaggttttg
gatacatttcgtattcttgccaaggtttcggggaaggatagtcaggagagaaaaaggaac
catatcaaagcacttcttgttgcagctagtgattgtgaacctctgtatataattcgtctt
ctgcagtcaaagttgaggattggtttggcagagcagactgtcttagtagctttggctcaa
gctgctgcatattctgaaagaccgtcggatccccctattgaagaagctgtaaaggttata
aagcaagtctattccgtgcaccctaaatatgataccattgtcagtgctcttctcagtgat
ggtgtgttgaagctccccgatacatgtacttttgtaccaggtgttcctattggtcctatg
ttagccaaacccacaaagggggtgtcagagattctcgacaaattccagaacagggatttc
acctgtgagtacaagtatgatggggaacgtgctcagatacactacctcgaagatggttca
gttgagatatatagtcgaaatgctgaaagaaatactggaaagtttcctgatgttattcaa
tcagtgcaaaggttcaagaagccttcagtaagctcatttgttctggattgtgaagttgtg
gcatttgaccgcaaaaacagtaaaattttgtctttccagaaactgagtaaccgcgctcgt
aaagatgtttccatcgatgacataacagttcaagtttgcatctttgcttttgatatattg
tatctcaatggtgaacaacttctccaagagcaattaaatgtccgtagaaagcatctttat
gactcatttgtggaagtaccaggagaatttaagtttgcgacagaagtaacatcaaacgat
cttgaagcaatacagacttttcttgatactgcaattgtggacagttgcgaaggtttgatt
gtcaaaacattaagtacagaagctacttatgagcctgcgaagaggtcaaacaactggttg
aaactgaagaaggattatatggacaacatcggagactccctagatttggttcctataggg
gcataccatggcagaggaaaacgtactggtggttatggaggctttcttcttgcttgttat
gatgatgagaaagaggaattccaatgcatatgcaagataggcaccggattttctgaaaaa
atgctcgaagagcgttcttccagtcttgaaagtcaagtgattcctcaaccaaagtcatac
taccgctttacagatgcaactaatccagatgtatggtttgaaccaactgaggtgtgggag
gttaaagctgcagatttgagtattagtcctgtttatcttgctgcagctggtgctgtggat
gcagtcaagggcatttctctgcgatttccacgcctgcttcgtgtacgagaagacaagaag
ccagaggaagctacaacgtctgatcaggttgctgatatgtatcgtgctcaaaagattaac
catggaaacaaccaagatgaagaggatgataactga

DBGET integrated database retrieval system