KEGG   Papaver somniferum (opium poppy): 113321759Help
Entry
113321759         CDS       T05758                                 

Definition
(RefSeq) uridine nucleosidase 1-like
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00240  Pyrimidine metabolism
psom00760  Nicotinate and nicotinamide metabolism
psom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    113321759
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    113321759
Enzymes [BR:psom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     113321759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 113321759
NCBI-ProteinID: XP_026425459
LinkDB All DBs
Position
11
AA seq 328 aa AA seqDB search
MGESSCLGFPSKLDKIIIDTDPGVDDSMAILMAFQTPELDILGLTTIFGNVTTKDATRNA
LILCETAGRTDVPVAEGSLEPLKGGAPRICDFVHGSDGMGNLSLPSPKGKKDEKSAVEFL
VDKISEFPGEVSILALGPLTNLALAVKSDASFASKVKRIVVLGGSFFASGNVNPAAEANI
YGDPEAADVVFTSGANIDVVGINITTQCTLTDEDLSDLRESKGRHAQFLSDMCKFYRDWH
VKSDGLCGIFLHDPVSFVALVRPDLFTFKKGVVRVETQGICVGHTLMDQGLKTWNSSNPW
TGYSPISVAWTVDVDKVVSYVKDLLMKR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggggagagtagctgcttgggatttccttctaaacttgataagatcatcatcgataca
gatcctggagtcgatgatagcatggcaatcttgatggcatttcaaacaccagagctggat
attttgggtttgacaacaatttttggtaatgttactaccaaagatgccactcgtaatgcc
ttgatactgtgtgagacagcaggacggactgacgttccagtggcggaaggaagcctcgag
cctctaaaggggggagctcctcgcatttgtgattttgttcatggttctgatggaatggga
aatttatctctgccttctcctaagggaaaaaaagacgagaaaagtgccgtagagtttcta
gttgataagatttctgaattccctggtgaagtatctatactcgccttgggtccattgaca
aatttggccttggcagttaaaagtgatgcatctttcgcaagcaaggtgaagagaatagtc
gtactgggtggttctttttttgcatctggaaatgtcaaccctgctgctgaagccaatatt
tatggagacccagaggcagctgatgttgttttcacttctggggctaatattgatgttgtt
ggcataaacatcacaacgcagtgcacactaacagatgaagacctctctgacttgagggaa
tcaaaaggaagacatgctcaattcttaagtgatatgtgcaaattctatagggattggcat
gtgaaatcagacggtttatgtgggatattcctccatgaccctgttagctttgtggcacta
gtccggcctgatcttttcaccttcaagaagggagttgtgagggtggagacacagggcatt
tgcgtcggccatactttgatggaccaaggactgaaaacatggaattcaagcaatccctgg
acaggctattcccccatttcagttgcatggacagttgacgtagataaagttgtttcatat
gttaaggaccttctaatgaaacgataa

DBGET integrated database retrieval system