KEGG   Papaver somniferum (opium poppy): 113322791
Entry
113322791         CDS       T05758                                 

Definition
(RefSeq) salutaridinol 7-O-acetyltransferase-like
  KO
K22095  (13S,14R)-1,13-dihydroxy-N-methylcandine 13-O-acetyltransferase [EC:2.3.1.285]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113322791
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.285  (13S,14R)-1,13-dihydroxy-N-methylcanadine 13-O-acetyltransferase
     113322791
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 113322791
NCBI-ProteinID: XP_026426728
LinkDB
Position
11
AA seq 471 aa
MATMSSAAVEVISKETIKPRNPTPYQLRNYNMSLLDQYSSLVYVPIILFYPAASDANSTG
SKHHDDLHLLKRSLSETLVHFYPMAGRMKDNMTVDCNDEGIDFFEVRIKGRMCDFMMKSD
AHLSLLLPSEVASTNFVKEAQVIVQVNMFDCGGTAICFCISNKIADACTMITFIRSLAGT
TNIARRGSSIAAPTTNQNLVPSFDSTSLFPPSEQLASQVSYPTQDSTSVDKLVSKRFVFD
AAKITSAREKLQSLMHDKYKCHRPTRVEVVSALIWKSAVKSAPPGSISTVTHAMNFRKKM
DPPLQDASFGNLCVVVTAVLPATTATTTNPATKKVSSTSNEEQVALDELSDFVALLRREI
DKVKGDKGCMEKIIQKFIYGHDASVAKDSDVEDKVTALFMTSWCKFGFYEADFGWGTPVW
VTTVPLIEPKYKNMVFMNDMKCGEGIEVWVNFLEDDMTKFEHHLREILQLF
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggcaacaatgtctagtgctgctgtagaagtgatctcgaaagaaacgattaaaccaaga
aatccaacaccatatcaacttagaaactacaatatgtcacttctcgaccaatattcttct
ctagtttatgttccgatcattcttttctaccctgctgcctccgacgctaatagtaccgga
agtaagcaccatgatgatcttcacttgcttaagaggtctctttctgaaacgctagttcac
ttttatccaatggctggtaggatgaaagacaacatgactgttgactgtaacgacgaaggt
attgactttttcgaagtaagaatcaaaggtagaatgtgtgacttcatgatgaaatcagat
gcacacttaagtctgcttcttccgtctgaagtcgcttccacgaacttcgtgaaggaagca
caggtgattgttcaagtgaacatgtttgattgcggtggaactgccatttgtttctgtata
tcaaacaagattgcagatgcatgcaccatgattaccttcattcgtagtttggcaggcacc
accaacatagctcgtcgtgggagctctattgctgcaccaaccacaaatcagaatttggtt
ccttctttcgattcgacatcactctttccacctagtgaacaattggcatctcaagtttcc
tatcctacacaggatagtaccagcgtagataaacttgtcagcaaaagatttgtgtttgat
gcggcaaagattacatctgcacgtgaaaaattgcaatccttgatgcatgataaatacaaa
tgccataggccgacaagggttgaggtagtttccgctttgatatggaagtcagcagtgaaa
tctgctccgcccggttctatatccactgtaacccatgccatgaactttagaaagaaaatg
gatccaccattacaagatgcgtcattcgggaatctttgtgtggttgttacagcagtatta
ccagcaacaacggcgacaacaacaaatccagcaaccaaaaaagttagtagtacgagtaat
gaagagcaagtggcacttgatgagttaagtgattttgtagccctattgaggcgcgaaata
gataaggtaaagggtgataaaggttgcatggagaaaatcattcaaaagttcatctatggt
catgatgcttccgtagcgaaagacagtgatgttgaagataaggtgacagctttgtttatg
actagctggtgcaagtttggattctacgaagctgattttggttggggaacgccagtttgg
gtaactactgttccattaattgagccaaagtacaagaacatggttttcatgaacgatatg
aaatgtggtgaaggaattgaagtgtgggtgaattttctggaggatgatatgaccaagttc
gaacaccacctaagagagatcctccaactgttttga

DBGET integrated database retrieval system