Papaver somniferum (opium poppy): 113325097 Help Entry 113325097         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113325097    04120 Ubiquitin mediated proteolysis     113325097   09126 Chromosome    03083 Polycomb repressive complex     113325097  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113325097    04121 Ubiquitin system [BR:psom04121]     113325097    03036 Chromosome and associated proteins [BR:psom03036]     113325097 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113325097 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      113325097    Cul7 complex      113325097 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113325097   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113325097 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB DUF3943 Motif Other DBs NCBI-GeneID:  113325097 NCBI-ProteinID:  XP_026429115 LinkDB All DBs Position 11:complement(127472898..127473323) Genome browser AA seq 141 aa AA seqDB search MVLCEGVNYLVSQNAIGISHTIKHAIEGIGSGHAIPLPNVRAEVLEKVIEYCDRCFQQQS WPAEYAKSNEALLFEILLAADYLNIASLQNLMCQAISGLVMGKSGVELRSALNIQGNFDA DEEAHLRNTLTGLGCVLERQD NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggtgttgtgtgaaggagtaaattatttggtaagtcagaatgccatcggcatatcccat acaattaagcacgcgattgaaggcatagggtctggtcatgccatcccactgcctaacgtc cgggctgaagtgctcgaaaaggtcatcgagtactgtgacagatgttttcagcagcagagc tggcctgctgaatatgcaaagtccaatgaagcattgctcttcgagattctcttggcagct gattatttgaacattgcaagtctgcagaacttgatgtgccaggcgattagcggtcttgtt atgggtaagagtggagtagagctccgcagtgccttgaacattcaaggaaactttgacgct gatgaagaggctcatcttcgaaacactttgactgggttgggctgtgttttggagcgccaa gattag

DBGET integrated database retrieval system