KEGG   Papaver somniferum (opium poppy): 113327576Help
Entry
113327576         CDS       T05758                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00020  Citrate cycle (TCA cycle)
psom00190  Oxidative phosphorylation
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113327576
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113327576
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113327576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 113327576
NCBI-ProteinID: XP_026430539
LinkDB All DBs
Position
Unknown
AA seq 284 aa AA seqDB search
MVTGLVLRSVSKKLSFSSNPSKLTLTRLYNAPPPPQEQKTEPKATDKSNHKTFQIYRWNP
DNPTKPELKNYSIDLKDCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNG
LACLTKIEPKEKESTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPAEEKGKEIY
QSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTDERL
AAINDEFKLYRCHTILNCARACPKGLNPGKQINTIKARQPGLLG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggttacaggcttagtcctcagatcagtctctaagaaactgtctttttcatcaaaccca
tcaaaactcaccctcacaagactttacaacgccccaccaccaccgcaagaacaaaaaacc
gaaccaaaagcaacagacaaatcaaaccacaaaacattccaaatctacagatggaatcca
gacaatccaacaaaaccagagctaaaaaattactcaatcgatttaaaagattgtggtcca
atggtgttagacgcactaatcaaaatcaagaacgagatcgatccaactttgacttttaga
cgatcgtgtcgtgaaggtatttgtggttcttgtgctatgaatattgatggttgtaatggt
ttagcttgtttaacaaagattgaacccaaggagaaagagagtacgattacaccgttgcct
catatgtttgtcattaaggatttggttgttgatatgactaacttctataatcaatataag
agtattgaaccatggttgaaaagaaagaatccagctgaggagaaagggaaagagatttat
cagagtaagaaagatagggctaaactcgatgggatgtatgaatgtattctatgtgcttgt
tgtagtacttcttgtcctagttattggtggaatcctgaatcttatcttggtcctgctgct
ttgcttcatgctaacaggtggataagtgatagccgtgatgagtacacagatgagcgttta
gctgcaattaacgacgagttcaagctataccggtgccatacaatattgaactgtgctcgt
gcctgcccgaagggattaaaccctggaaagcagatcaacaccatcaaggcacgccagcct
ggcctactgggctaa

DBGET integrated database retrieval system